our lives are but vapor, best smell the one we have at this time and place.
I The Lord God, I change not, My holiness. You will be judged.
| maybe the internet? |
| Relax, do not get tense, have no fear. All is for the best. How can you fear change when your life is hid with Me in God, who changeth not – and I Am the same yesterday, today, and forever. You must learn poise, soul-balance and poise, in a vacillating, changing world. |
so glad you both knew; even as far back a 1988…
David Buckle’s dated review.
| “Say not ye, There are yet four months, and then comes harvest? behold, I say unto you, Lift up your eyes, and look on the fields; for they are white already to harvest.” John 4:35 |
| When you think of those of whom you read who are in anguish, do you ever think how My Heart must ache with the woe of it, with the anguish of it? If I beheld the city and wept over it, how much more should I weep over the agony of these troubled hearts, over lives that seek to live without My sustaining Power. “They will not come into Me that they might have Life.” Live to bring others to Me, the only Source of Happiness and Heart-Peace. |
Collection by David Buckle
My Consolation Oh Jesus, come and walk with us and let us feel Thy very nearness. I walk with you. Oh! think, My children, not only to guide and comfort you and strengthen and uphold, but for solace and comfort for Myself. When a loving child is by you, is the nearness only that you may provide protection and help for that little one? Rather, too, that in that little child you may find joy and cheer and comfort in its simplicity, its Love, its trust. So, too, is it in your power to comfort and bring joy to My Heart. And I will walk among you, and will be your God, and ye shall be My people. personal safety ( He is in control )
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
……………… disqus.com/by/dave_buckle
Bethany Hamilton Surf Mar Soul Surfer Surf Girls Beach Girls Christian Inspiration Surfs Up Surfing Good People
Soul Surfer: The Bethany Hamilton Story – Inspiring People, despite that she did return to competing.
So SadSad LoveSweet StoriesCute Stories Beautiful Stories
Vietnam WarHistory FactsWorld HistoryHistory WeirdFunny HistoryHistory QuotesHistory TimelineInteresting HistoryInteresting Facts
Sad StoriesTouching StoriesAngel StoriesI Look To YouAll I Ever WantedMilitary LoveMilitary MemesSincerityGod Bless America
I’m crying. This is how our Marines honor each other with respect. How does the president honor them.cutting or stopping their pay. >>> I can’t stop crying
https://collactiona.files.wordpress.com/2019/07/0-5.jpg
Love The LordGod Is GoodGods LoveI Love HimLord And SaviorGod JesusGod Loves MeJesus Loves MeFaith In Humanity
“Jesus Is My Savior!!!!!” by johnnawood ❤ liked on Polyvore featuring interior, interiors, interior design, home, home decor and interior decoratingDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Military HumorMilitary HistoryMilitary TacticsMilitary LoveUs HistoryHistory FactsAmerican HistoryAmerican WarReal Hero
Do not mess with The Ghost.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Bible ScripturesChristian LivingChristian LifeChristian QuotesWord Of GodFaith QuotesBible QuotesBattle GroundPrayer Warrior
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Soldado UniversalFaith In HumanityWe Are The WorldFight For UsMilitary LoveMilitary SaluteReal HeroAmerican SoldiersToy Soldiers
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Ak47Out Of TouchGuns And AmmoPro GunLiberal LogicGun Rights2nd AmendmentSo TrueFirearms
We’re up here at the vacation home in the pines for a long weekend with four dogs (yea, we brought …David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Genealogy ResearchFamily GenealogyGenealogy WebsitesAncestry RecordsMilitary RecordsFamily MattersFree Family TreeFamily SearchRecord Collection
Do you have a military hero in your family? Search Ancestry records to discover family draft cards, passenger lists, and more. Discover more today.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Real HeroBefore UsUs ArmyArmed ForcesMilitary HistoryMilitary PhotosWorld War TwoWorld HistoryWwii
Audie Murphy received every U. decoration for valor available to Army ground personnel at the time. He earned the Silver Star twice in three days, two Bronze Star Medals, three Purple Hearts, the Distinguished Service Cross, and the Medal of Honor.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Gods Not DeadEwan McgregorGod Loves MeJesus Loves MeLord And SaviorGod JesusJesus ChristChristian MemesChristian Facebook
Our Lord and savior obi wan kanobiDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Royal MarinesArmy HumorMilitary HumorMilitary LifeMilitary ArtMilitary StyleMarine CorpsMilitary CareersMilitary Quotes
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Historia UniversalIndian TribesNative IndianNative American HistoryNative American IndiansCode TalkerAmerican CodeNavajo NationUsmc
“Sam Holiday” ~ WWII Veteran & Navajo Code Talker by carleneDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Marine CorpsMilitary QuotesMilitary HumorMilitary LifeMilitary PersonnelMilitary ServiceGod Bless AmericaAmerica AmericaUs Army
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Leonard Nimoy, Spock, Star Trek, Tbbt, O Drama, Guns And Ammo, Pro Gun, So True, Great QuotesDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Famous MarinesMilitary VeteransMilitary ServiceFamous VeteransJoining The MilitaryHollywood ActorHollywood StarsNavy ReserveSterling Hayden
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Jesus TodayMy JesusI Love JesusJesus Loves MeJesus FreakJesus HelpTrust In JesusGod Help MeIn God We Trust
jesus_teddyDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Military VeteransMilitary ServiceMilitary MenMilitary HistoryHollywood MenHollywood StarsClassic HollywoodFamous VeteransClassic Tv
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Military HumorMilitary LifeMilitary QuotesMilitary HistoryUsmc QuotesMilitary BoxMarine QuotesSnipersChris Kyle Sniper
devildoggraphix: “Two years ago today, America lost a great warrior and hero. RIP Chris Kyle. You will never be forgotten! “It was my duty to shoot the enemy, and I don’t regret it. My regrets are for…David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Military VeteransMilitary ServiceMilitary MenMilitary HistoryFamous VeteransMarine ReservesFamous MenFamous CelebritiesEd Mcmahon
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Us MarinesMarines In CombatFallen HeroesFallen SoldiersRemember The FallenSupport Our TroopsAmerican PrideReal HeroMarine Corps
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Phonetisches AlphabetAlphabet SymbolsNato Phonetic AlphabetSign Language AlphabetMorse Code LearnCode CodeCode ArtElk HuntingHunting Guns
Phonetic Alphabet/ Morris Code…I have always wanted to learn this. Phonetic Alphabet/ Morris Code…I have always wanted to learn this.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Old Hollywood StarsHollywood ActorClassic HollywoodVintage HollywoodMilitary VeteransMilitary ServiceMilitary MenMilitary HistoryMilitary Personnel
William Holden served as a lieutenant in the US Army Air Corps during World War II.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Famous MenFamous CelebritiesFamous PeopleHollywood ActorHollywood StarsMilitary VeteransMilitary ServiceJoining The MilitaryAmerican Actors
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Once A MarineMarine MomUs Marine CorpsMarine Corps HumorMarine QuotesUsmc QuotesMilitary HumorMilitary QuotesMilitary Life
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Military HumorArmy HumorMilitary LifeMilitary BoxArmy LifeTroopsMarine CoreKnock KnockFunny Army
Smilin’ and wavin’David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Liberal HypocrisyPoliticiansLiberal LogicGun QuotesTruck QuotesLiberalismPro Gun2nd AmendmentGun Rights
Add murder by scalpel (abortions) to the tune of Almost a million per year in the US!David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Real Life HerosMemes In Real LifeReality Of LifeTruth Of LifeTrue QuotesApj QuotesMotivational QuotesInspirational QuotesFunny Quotes
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Military VeteransMilitary ServiceFamous VeteransHenry ManciniJoining The MilitaryArmed ForcesMilitary HistoryFamous MenWorld War Ii
Henry Mancini-Army Air Composer of the dreamy “Moon River” and more greatmusic.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Star Trek CharactersAmazing GiftsSideshow CollectiblesStar Wars ArtGeek CultureAsoka TanoRecommended ReadingCarrie FisherChopsticks
High end, luxury art prints from Comics, Film and more. Limited Editions and hand-signed – these make the most amazing gifts for that discerning geek in your life.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Marine Corps BasesHero’s JourneyReal HeroJanuary 26Fallen HeroesHome Of The BraveAmerican SoldiersGod Bless AmericaArmed Forces
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
2:57Lord And SaviorTrue RepentanceForgiveness In The BibleForgiveness Quotes ChristianChristian QuotesFaith QuotesLife Quotes LoveBible QuotesBiblical Quotes
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
WordPressCommon SensePro GunFreedomGun RightsGun ControlSelf Defense2nd AmendmentGuns And Ammo
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Poppies PoemVeterans Day PoppyVeterans Day ActivitiesMemorial Day ActivitiesRemembrance Day ActivitiesHoliday ActivitiesRemembrance SundayRemembrance Day QuotesThinking Day
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
I SmileMake Me SmileSincerityBelieveLook At YouAll That MattersNo Me ImportaA Good ManThis Man
This man!” It always restores my faith in humanityDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Military VeteransMilitary ServiceFamous VeteransJoining The MilitaryFamous NamesHollywood ActorOld HollywoodAmerican PresidentsActing Career
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Bulldog NamesBulldog MascotBulldog PuppiesMarine MomUs Marine CorpsUs MarinesUsmcSemper FidelisWas
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
I Love AmericaGod Bless AmericaLest We ForgetAlways RememberWe Will Never ForgetWe RememberAmerican PrideAmerican HistoryAmerican Freedom
I will always remember this New York skyline.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Bonanza Tv ShowFamous VeteransHollywood ActorClassic HollywoodOld HollywoodHollywood StarsThe Lone RangerOld Tv ShowsMichael Landon
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Bible PicturesBiblical ArtHeart Of JesusGod JesusPictures Of Jesus ChristImage JesusIn Christ AloneJesus Loves YouSon Of God
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
SayingsPro GunGun RightsGun ControlSelf DefenseConcealed Carry2nd AmendmentCool GunsAwesome Guns
that is the freedom to bear arms! I suppose its not really that funny that we don’t see these signs more often.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
We Are The WorldIn This WorldMake Me HappyMake Me SmileFor King And CountryJust DreamAll That MattersFunny PicturesFunny Images
This is one beautiful person. So so beautiful. I wish more people had her thought of mind. Its amazing how positive people can be.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
American VeteransAmerican SoldiersFort BelvoirArmy HistoryBlack HistoryProsthetic LegWounded WarriorLife Goes OnHome Of The Brave
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Fantastic FoxFabulous FoxCute FoxWild DogsMammalsBaby AnimalsFunny AnimalsCute AnimalsAnimals And Pets
All of These Foxes! — foxy-lover: Comfortable place to sleepDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Military VeteransMilitary ServiceMilitary RanksMilitary LifeUsmcMarinesBattle Of SaipanFamous VeteransUs Marine Corps
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Funny MilitaryMilitary HumourArmy HumorMarines FunnyUs MarinesMilitary PoliceArmy FunnyMilitary SaluteFemale Marines
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Marines FunnyUs MarinesMilitary SuitMarine BabyOnce A MarineMarines GirlfriendUs Marine CorpsMarine HumorSupport Our Troops
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Sweet StoriesCute StoriesAmazing People StoriesReal HeroReal Life HerosGood PeopleFunny PeopleSpecial PeopleHuman Kindness
So sad:/ True life hero. Let people like him be never forgottenDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
0:11
Motorcycle Cargo TrailerPull Behind Motorcycle TrailerMotorcycle CampingMotorcycle GarageTeardrop Trailer PlansDog TrailerCargo Trailer ConversionCafe BikeCargo Trailers
Bushtec Pull Behind Motorcycle Trailer for the Dogs!David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Military HomecomingNavy MilitaryMilitary SpouseDoomsday SurvivalUs Army RangersJoining The MilitaryHomecoming PicturesMarines GirlfriendNavy Air Force
Thank you active, veteran, retired, and reservist military members, for your service. We’re proud to show our appreciation with 10% off any Purple order for you and your dependents.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Marine Corps HistoryUs Marine CorpsAmerican UniformWw1 SoldiersWwiOnce A MarineMilitary HumorMilitary HistoryUs Marines
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Underground RailroadAmerican WomenAfrican American HistoryHarriet TubmanJohn TubmanGreat WomenAmazing WomenAmerican Civil WarBlack People
Harriet Tubman is an influential African American because she escaped from slavery to become a leading abolitionist and created the Underground Railroad.” The Biography Channel website.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Black History MonthBlack History FactsWomen In HistoryAfrican American HistoryHeldAfrican American WomenAfrican AmericansLook At YouBlack Pride
Mary Eliza Mahoney, R. ~ May 1845 – January, 1926 Among the first women in Boston to register to vote Mary Mahoney, born in Boston in was the first black to study and work as a professionally trained nurse in the United States, graduating inDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Military MemesFunny MilitaryMarines FunnyMilitary LifeArmy LifeMilitary ServiceMarine Corps HumorUsmc HumorDad Humor
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Military VeteransMilitary ServiceMilitary RanksMilitary LifeUsmcMarinesBattle Of SaipanFamous VeteransUs Marine Corps
Lee Marvin left school and joined the US Marine Corps as a sniper scout. He was wounded in action at the Battle of Saipan during WWII and was awarded the Purple Heart and discharged at the rank of Private First Class.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Native American WisdomNative American HistoryAmerican IndiansAmerican CodeCode TalkerMexico PeopleJapanese AmericanIndian TribesSemper Fi
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Charles DurningFamous VeteransCharles BronsonMilitary PhotosMilitary HistoryMilitary ServiceAmerican WarFamous FacesGuam
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
American History LessonsAfrican American History MonthHistory For KidsBlack History Month QuotesBlack History Month ActivitiesLife Quotes LoveWorld History ClassroomHistory TeachersWordPress
75 Inspirational Quotes About Race, Love & Equality To Celebrate Black History Month | YourTangoDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
It Doesnt MatterSincerityThis Is Your LifeAll That MattersVerbatimQuotable QuotesMotivational QuotesInspirational QuotesHumorous Quotes
Bad news is: you cannot make people like, love, understand, validate, accept or be nice to you. You can’t control them either. Good news is: it doesn’t matterDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Bethany HamiltonSurf MarSoul SurferSurf GirlsBeach GirlsChristian InspirationSurfs UpSurfingGood People
Soul Surfer: The Bethany Hamilton Story — Inspiring People, Books and Films, champion surfer that lost her arm to a shark, despite that returned to competing.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Choppy Bob With BangsHeavy BangsShort Hair With BangsHaircuts With BangsBob HaircutsBlunt BangsBlunt FringeLong Face HaircutsShort Choppy Bobs
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
eBay
North Vietnam, Vietnam War, Military Veterans, Military Art, Howard Hughes, Navy Air Force, Paratrooper, United States Army, Assassins CreedDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Missing In ActionKilled In ActionVietnam VetsSouthwest Airlines
The remains of an American hero were finally flown home from Vietnam this week. His son was the pilot. – TheBlazeDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Navajo WeavingNavajo RugsCode TalkerNavajo PeopleTaos New MexicoNavajo NationAmerican StoryLand Of EnchantmentMystery Of History
Code TalkerDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Wolf HybridFennecSpirit AnimalStuffed AnimalsSave WildlifeMundo AnimalFox AnimalFunny AnimalsAnimals And Pets
Burgess Animal Book for Children Learning GuideDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Touching StoriesSweet StoriesSad StoriesAwesome StoriesFaith In Humanity Restored MilitaryHuman KindnessUsmcGood PeopleStupid People
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Superb QuotesAmazing People QuotesQuotes About Mean PeopleInspiring People QuotesBest QuotesFavorite QuotesQuotes About Ignorant PeopleTruth Quotes LifeCheap People Quotes
20 Amazing Quotes About Life Yes my boyfriend have learn me this noy always arguing en when walk alway from it and let people who are wrong be and stand above it.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Wisdom QuotesQuotable QuotesConfucius QuotesPositive QuotesMotivational QuotesMe QuotesMessage QuotesLove For Child QuotesFlower Child Quotes
This “screamed” Montessori to me! When a child misbehaved at free-choice time, I instructed my staff to “fix” or restructure the environment.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
American HistoryHistory FactsWorld HistoryWorld War IiAmerican PrideMilitary MemesMilitary HistoryMilitary DogsFun Facts
His name was Audie Murphy. Like so many other young men wanting to fight for their country, Audie Murphy lied about his age in his attempt to enlist. But it was not his age that kept him out of the Marines;David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Speak The Truth QuotesTelling The Truth QuotesWise QuotesQuotable QuotesFool QuotesSocrates QuotesFamous QuotesTruth And LiesMotivational Quotes
Quotes No one is more hated than he who speaks the truth.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
I Like DogsInspirierender TextDog LifeQuote PostersQuotable QuotesMotivational QuotesInspirational QuotesPositive QuotesDecir No
Discover and share Dog Quotes By Mark Twain. Explore our collection of motivational and famous quotes by authors you know and love.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Military WifeMilitary HumorMilitary UniformsNavy UniformsNavy MilitaryMilitary FamiliesMilitary ServiceMilitary QuotesCoast Guard Uniforms
The United States Military: Soldier = Army, Sailor = Navy, Airman = Airforce, Coastguardsman = Coastguard, and Marine = Marine CorpsDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Be Wise QuotesBeing Smart QuotesQuotes Of WisdomInspirational And Motivational QuotesInspirational ThoughtsWiser QuotesPeople QuotesQuotable QuotesGreat Quotes
I have a thief with a bad mouth. A vagabond who’d do anything for a dime, including slavery. Another mathmatician plus politician who puts his left hand in everything and anything. A psychopath! And a highly diplomatic dwarf! As my daily companion!David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Wisdom QuotesQuotable QuotesWords QuotesQuotes To Live ByMotivational QuotesWise WordsLife QuotesInspirational QuotesPlato Quotes
Positive quotes about strength, and motivationalDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Military VeteransMilitary ServiceMilitary MenMilitary HumorVietnam VeteransVietnam WarMilitary HistoryAnime MilitaryFamous Veterans
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Jack WardenMilitary VeteransMilitary ServiceFamous VeteransMerchant MarineParatrooperReal HeroAmerican SoldiersUs Army
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
World HistoryHistory BooksAmerican PresidentsUs PresidentsAmerican HistoryAmerican SoldiersAmerican PrideSenator MccainVietnam War
WALKING WOUNDED: McCain’s torture left him disfigured and permanently disabled. He’s pictured being greeted by then-President Richard Nixon upon his release in 1973David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Military VeteransMilitary ServiceFamous VeteransJoining The MilitaryFamous MenFamous FacesJanssenHollywood StarsClassic Hollywood
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Christian JokesChristian Rock BandsChristian SingersChristian MusicChristian LifeJesus ArmySkillet BandJesus Loves MeGod Loves Me
John cooper (skillet) (right) and Toby Mac (left). Just wait until you see Jesus’ army.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Great QuotesWise QuotesArt Of War QuotesQuotable QuotesWisdom SayingsMotivational QuotesInsightful QuotesInspirational QuotesQuotes Pics
Any person capable of angering you becomes your aster; he can anger you only when you permit yourself to be disturbed by him.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Anthony HopkinsMilitary VeteransMilitary ServiceFamous VeteransHollywood ActorHollywood StarsClassic HollywoodOld HollywoodClassic Films
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
American SoldiersMilitary HistoryClassic HollywoodHollywood StarsClassic TvMilitary ServiceMilitary VeteransMilitary MenFamous Veterans
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Military ServiceMilitary VeteransMilitary ArtHollywood ActorHollywood StarsClassic HollywoodFamous MenFamous PeopleFamous Faces
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Military ServiceMilitary VeteransMilitary MenMilitary HistoryJoining The MilitaryAmerican SoldiersAmerican ActorsFamous MarinesSupport Our Troops
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
All That MattersFamily MattersPraise GodGodly WomanEncouragement QuotesFaith QuotesMe QuotesBible QuotesQueen Quotes
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Wisdom QuotesQuotable QuotesQuotes To Live ByLife QuotesTaoism QuotesLao Tzu QuotesLong Distance LoveBien DitVerbatim
Care about what other people think and you will always be their prisoner – Lao TzuDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Military VeteransMilitary ServiceFamous VeteransJoining The MilitaryPeople Of InterestWorld War OneRed CrossMilitary HistoryArmed Forces
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Military VeteransMilitary ServiceFamous VeteransCelebrities Then And NowYoung CelebritiesJoining The MilitaryVietnam War PhotosFamous MenFamous Faces
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Christian HumorChristian LifeChristian FriendsFunny Christian JokesReligion CatolicaOur LadySoli Deo GloriaGods Not DeadJesus Cristo
The 50 best Christian memes from Memes for JesusDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Military VeteransMilitary ServiceMilitary MenFamous VeteransBrian KeithHollywood StarsClassic HollywoodOld HollywoodHollywood Icons
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Hollywood StarsClassic HollywoodOld HollywoodMilitary VeteransMilitary ServiceFamous VeteransPeople Of InterestCelebrities Then And NowFamous People
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Military VeteransMilitary MenMilitary ServiceMilitary HistoryUs Coast GuardCoast Guard AcademyFamous VeteransAmerican SoldiersAmerican Veterans
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Audrey Tautou in “Amelie” http://www.pinterest.com/davejbuc3
Military ServiceMilitary MenMilitary HistoryGeorge ReevesFamous VeteransHollywood ActorHollywood StarsClassic Hollywood
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Military VeteransMilitary ServiceMilitary MenMilitary HistoryFamous VeteransSenate MajorityPurple HeartsSupport Our TroopsBarbers
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Precious ChildrenBeautiful ChildrenBeautiful BabiesBeautiful StoriesChurch MemesChurch HumorChurch SignsBaby PicturesCute Pictures
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Military ServiceMilitary VeteransAmerican SoldiersAmerican ActorsOld Movie StarsFamous MenFamous FacesHollywood StarsClassic Hollywood
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Military VeteransMilitary ServiceMilitary MenMilitary HistoryFamous VeteransHollywood ActorHollywood StarsPeople Of InterestFamous Celebrities
Hollywood ActorHollywood StarsMilitary VeteransMilitary ServiceMilitary HistoryWw2 HistoryPerry MasonJoining The MilitaryFamous Veterans
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Famous MarinesMilitary VeteransMilitary ServiceFamous VeteransJoining The MilitarySupport Our TroopsAmerican SoldiersKorean WarFamous Men
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Gun QuotesWise QuotesPolitical ViewsPolitical MemesPolitical EqualityGun ControlControl FreaksSubmachine GunRandom Stuff
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Roy ScheiderFamous MenFamous CelebritiesFamous FacesMilitary VeteransMilitary ServiceFamous VeteransAmerican SoldiersAmerican Actors
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Military PersonnelMilitary VeteransMilitary ServiceMilitary MenMilitary HistoryFamous VeteransChief Of StaffAmerican SoldiersFamous Men
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Buddy HackettMilitary VeteransMilitary ServiceFamous VeteransJoining The MilitaryComedy TvAmerican SoldiersFamous MenUs Army
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Military VeteransMilitary ServiceMilitary MenMilitary HistoryFamous VeteransRobert CummingsJoining The MilitaryApprisAmerican Veterans
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Military VeteransMilitary ServiceMilitary MenFamous VeteransJoining The MilitaryFamous NamesWw2 HistoryReal HeroAircraft Carrier
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Sherman HemsleyHollywood StarsClassic HollywoodFamous MenFamous FacesFamous VeteransMilitary ServiceMilitary VeteransBlack Actors
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Military ServiceMilitary VeteransHollywood StarsOld HollywoodFamous VeteransJoining The MilitaryDavid NivenColonelFamous People
(Right) David Niven as a Civilian – (Left) David Niven as a SoldierDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Famous MarinesMilitary ServiceMilitary VeteransHollywood ActorHollywood StarsPeople Of InterestFamous VeteransKorean WarAmerican Soldiers
At joined the Marine Corps, serving 4 years as a field radio operator in Japan and Hawaii and honorably discharged inDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
SincerityFaith In GodFaith BibleChristian HumorChristian SayingsChristian FaithChristian PicsChristian CartoonsChristian Encouragement
If ya ain’t got Jesus, ya ain’t got nuttin buddyDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Military VeteransMilitary ServiceMilitary MenMilitary HistoryFamous VeteransHollywood ActorHollywood StarsReal HeroSupport Our Troops
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Eddie RickenbackerFighter PilotWw2 AircraftMilitary AircraftMedal Of Honor RecipientsPlane And PilotFlying AcePhoto AvionMilitary Personnel
history-museum: “ ace Robert S. Johnson, the first American pilot to surpass Eddie Rickenbacker’s WWI victory total of sits in his plane. Taken between 30 January and 20 FebruaryDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Good QuotesFunny QuotesQuotes To Live ByMotivational QuotesLife QuotesInspirational QuotesDaily QuotesKey QuotesSerious Quotes
This set of Funny JokesDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Tennessee Ernie FordMovies PlayingBook PeopleKinds Of PeopleLiver DiseaseWorld War IiWwiiSixteen TonsMovie Stars
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Sid CaesarMilitary VeteransMilitary ServiceFamous VeteransAmerican ExceptionalismOld Hollywood StarsClassic HollywoodHollywood GlamourCelebrities Then And Now
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Cinematic PhotographyGreat MoviesDestinMovie ShotsFrench FilmsFilm InspirationMoving PicturesAmelie HaircutAudrey Tautou
Le fabuleux destin d’Amélie Poulain – Jean-Pierre Jeunet (France) – 2011David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Presidential LibrariesPresidential HistoryPresidential TriviaWorld War IWorld HistoryMilitary VeteransMilitary ServiceMilitary MenMilitary History
Gerald Ford (July 1913 – December U. President) – United States Naval Reserve Lieutenant Commander World War II combat on USS Monterey, discharged inDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Real HeroAmerican SoldiersClassic HollywoodOld HollywoodHollywood StarsCaptain KangarooCat BallouAcademy Award WinnersOscar Winners
Actor Lee Marvin (left) star of “The Dirty Dozen” movie franchise. Bob Keeshan (top right) aka “Captain Kangaroo”, Mr. Rogers (bottom right). All 3 men, certified authentic war heroes. Who would’ve guessed.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Military InsigniaMilitary PersonnelMilitary VeteransMilitary ServiceFamous VeteransUs HistoryHistory FactsAmerican HistoryAmerica Civil War
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Funny Army MemesArmy HumorArmy JokesFunny JokesFunniest MemesFunny MilitaryArmy LifeMilitary LifeMilitary Style
The 13 funniest military memes of the week – We Are The MightyDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
World HistoryWorld War IiJapanese AmericanIwo JimaHistoria UniversalUnited States ArmyInteresting HistoryUs ArmyMilitary History
Ben Kuroki – became a dorsal turret gunner on a Liberator. He flew a total of 58 combat missions during World War II, and is the only Japanese-American in the United States Army Air Forces to serve in combat operations in the Pacific theatre
Military VeteransMilitary ServiceFamous VeteransJack PalanceReal HeroAmerican SoldiersWorld HistoryWorld War IiFamous Names
Army LifeArmy MomUs ArmyArmy GirlfriendBoyfriendI Love AmericaGod Bless AmericaNight AmericaAmerica 2
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Real HeroWorld War TwoBand Of BrothersBrothers MovieMilitary HistoryWw2 HistoryMilitary HumorMilitary VeteransMilitary Life
Band Of Brothers Hero, Darrell ‘Shifty’ Powers DiesDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Marine LoveDistance LoveLong DistanceHistorical PicturesThe Good Old DaysOur WorldVintage LoveOnce Upon A TimeWwii
Dedicated to the wonderful fashion/makeup/people/culture of the and None of the content posted on here is mine unless otherwise stated. David Buckle
Bush FamilyBarbara BushUs PresidentsAmerican PresidentsAmerican HistoryGreatest PresidentsAmerican PrideNavy VeteranMilitary Veterans
#TDIH (1941) The Japanese attack #PearlHarbor. That surprise attack changed everything, of course, and many Americans rushed to enlist in the #USArmy, #USNavy, or #USMC. One of these men was #GeorgeHWBush. #WWIIDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Buddy EbsenMilitary VeteransMilitary ServiceJoining The MilitaryUs Coast GuardFamous FacesFamous MenFamous PeopleClassic Hollywood
Buddy Ebsen – Best remembered as “Jed Clampett” on TVs “The Beverly Hillbillies”. Ebsen was accepted and commissioned a Lieutenant in the Coast Guard. He served on the Navy frigate USS Pocatello, a weather ship that served on Station Able.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Military VeteransMilitary ServiceFamous VeteransFamous NamesAmerican FreedomFamous CelebritiesAmerican VeteransHollywood StarsOld Hollywood
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Military VeteransMilitary ServiceFamous VeteransAmerican SoldiersFamous MenSecond LieutenantUs ArmyArlington VirginiaHollywood Stars
🌟Forrest Tucker / / 67 years old / Lung cancerDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Zazzle
Black PowerBooker TBlack History MonthBlack Is BeautifulAfrican DiasporaPanamaBlack PeopleAfrican American HistoryWashington
Booker Taliaferro Washington (April 1856 – November was an African-American educator, author, orator, and advisor to presidents of the United States. Between 1890 and Washington was the dominant leader in the African-American community.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
North VietnamVietnam WarFirst Indochina WarPaganismCrossstitchHanoiSidney MccainKingstonCold War
John McCain recovers from a broken leg after being shot down over Hanoi. The Hanoi Hilton’s most famous captive was probably US Senator John McCain, who was held there from after being shot down over Hanoi and hauled out of a nearby lake by an angry mob.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Cindy MccainWe Are FamilyDonald TrumpDonald Tramp
The president called Cindy McCain on Friday to offer her his best wishes and ask after her husband, Sen.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Vietnam HistoryVietnam WarHistory OnlinePassed AwayColonelPilotsAmerican HistoryWarUs History
Colonel George Robert Hall, a Vietnam War veteran who endured one of the longest captivities as a POW in American history, has died after he lost hisDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Vietnam VeteransUsmcMilitary HistoryWorld War IiWar ImageBattle Of Hamburger HillNorth VietnamParatrooperAmerican History
May A Shau Valley, South Vietnam. Medics rush an injured paratrooper to an evacuation helicopter during fighting on ‘Hamburger Hill’ in the Vietnam War. Image by © Bettmann/CORBISDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Military HumorMilitary GearMilitary VeteransMilitary ServiceVeteran HatsVietnam VetsUs VetsAmerican SoldiersUsmc
Gift ideas: Vietnam Veteran caps ,I want this cap.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpgPinterest
Collection by David Buckle • Last updated 2 weeks ago281 Pins • 154 Followers today is My Consolation Oh Jesus, come and walk with us and let us feel Thy very nearness. I walk with you. Oh! think, My children, not only to guide and comfort you and strengthen and uphold, but for solace and comfort for Myself. When a loving child is by you, is the nearness only that you may provide protection and help for that little one? Rather, too, that in that little child you may find joy and cheer and comfort in its simplicity, its Love, its trust. So, too, is it in your power to comfort and bring joy to My Heart. And I will walk among you, and will be your God, and ye shall be my people.motivatorOther Pins
Choppy Bob With BangsHeavy BangsShort Hair With BangsHaircuts With BangsBob HaircutsBlunt BangsBlunt FringeLong Face HaircutsShort Choppy Bobs
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Bethany HamiltonSurf MarSoul SurferSurf GirlsBeach GirlsChristian InspirationSurfs UpSurfingGood People
Soul Surfer: The Bethany Hamilton Story — Inspiring People, Books and Films, champion surfer that lost her arm to a shark, despite that returned to competing.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Good PeopleAmazing PeopleSo SadSad LoveSweet StoriesCute StoriesBeautiful StoriesTry Not To CryMake You Cry
Sad but strong boy<< ok but no you don’t get it. The flag would go to his mother( the mans wife) before it goes to the kid.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Graffiti ArtStreet Art BanksyBanksy ArtBanskyBanksy QuotesStreet Art QuotesLand ArtPosterKarma
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Vietnam WarHistory FactsWorld HistoryHistory WeirdFunny HistoryHistory QuotesHistory TimelineInteresting HistoryInteresting Facts
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Etsy
Sad StoriesTouching StoriesAngel StoriesI Look To YouAll I Ever WantedMilitary LoveMilitary MemesSincerityGod Bless America
I’m crying. This is how our Marines honor each other with respect. How does the president honor them.cutting or stopping their pay. >>> I can’t stop cryingDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Love The LordGod Is GoodGods LoveI Love HimLord And SaviorGod JesusGod Loves MeJesus Loves MeFaith In Humanity
“Jesus Is My Savior!!!!!” by johnnawood ❤ liked on Polyvore featuring interior, interiors, interior design, home, home decor and interior decoratingDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Military HumorMilitary HistoryMilitary TacticsMilitary LoveUs HistoryHistory FactsAmerican HistoryAmerican WarReal Hero
Do not mess with The Ghost.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Bible ScripturesChristian LivingChristian LifeChristian QuotesWord Of GodFaith QuotesBible QuotesBattle GroundPrayer Warrior
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Soldado UniversalFaith In HumanityWe Are The WorldFight For UsMilitary LoveMilitary SaluteReal HeroAmerican SoldiersToy Soldiers
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Ak47Out Of TouchGuns And AmmoPro GunLiberal LogicGun Rights2nd AmendmentSo TrueFirearms
We’re up here at the vacation home in the pines for a long weekend with four dogs (yea, we brought …David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Genealogy ResearchFamily GenealogyGenealogy WebsitesAncestry RecordsMilitary RecordsFamily MattersFree Family TreeFamily SearchRecord Collection
Do you have a military hero in your family? Search Ancestry records to discover family draft cards, passenger lists, and more. Discover more today.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Real HeroBefore UsUs ArmyArmed ForcesMilitary HistoryMilitary PhotosWorld War TwoWorld HistoryWwii
Audie Murphy received every U. decoration for valor available to Army ground personnel at the time. He earned the Silver Star twice in three days, two Bronze Star Medals, three Purple Hearts, the Distinguished Service Cross, and the Medal of Honor.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Gods Not DeadEwan McgregorGod Loves MeJesus Loves MeLord And SaviorGod JesusJesus ChristChristian MemesChristian Facebook
Our Lord and savior obi wan kanobiDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Royal MarinesArmy HumorMilitary HumorMilitary LifeMilitary ArtMilitary StyleMarine CorpsMilitary CareersMilitary Quotes
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Historia UniversalIndian TribesNative IndianNative American HistoryNative American IndiansCode TalkerAmerican CodeNavajo NationUsmc
“Sam Holiday” ~ WWII Veteran & Navajo Code Talker by carleneDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Marine CorpsMilitary QuotesMilitary HumorMilitary LifeMilitary PersonnelMilitary ServiceGod Bless AmericaAmerica AmericaUs Army
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Leonard Nimoy, Spock, Star Trek, Tbbt, O Drama, Guns And Ammo, Pro Gun, So True, Great QuotesDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Famous MarinesMilitary VeteransMilitary ServiceFamous VeteransJoining The MilitaryHollywood ActorHollywood StarsNavy ReserveSterling Hayden
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Jesus TodayMy JesusI Love JesusJesus Loves MeJesus FreakJesus HelpTrust In JesusGod Help MeIn God We Trust
jesus_teddyDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Military VeteransMilitary ServiceMilitary MenMilitary HistoryHollywood MenHollywood StarsClassic HollywoodFamous VeteransClassic Tv
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Military HumorMilitary LifeMilitary QuotesMilitary HistoryUsmc QuotesMilitary BoxMarine QuotesSnipersChris Kyle Sniper
devildoggraphix: “Two years ago today, America lost a great warrior and hero. RIP Chris Kyle. You will never be forgotten! “It was my duty to shoot the enemy, and I don’t regret it. My regrets are for…David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Military VeteransMilitary ServiceMilitary MenMilitary HistoryFamous VeteransMarine ReservesFamous MenFamous CelebritiesEd Mcmahon
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Us MarinesMarines In CombatFallen HeroesFallen SoldiersRemember The FallenSupport Our TroopsAmerican PrideReal HeroMarine Corps
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Phonetisches AlphabetAlphabet SymbolsNato Phonetic AlphabetSign Language AlphabetMorse Code LearnCode CodeCode ArtElk HuntingHunting Guns
Phonetic Alphabet/ Morris Code…I have always wanted to learn this. Phonetic Alphabet/ Morris Code…I have always wanted to learn this.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Old Hollywood StarsHollywood ActorClassic HollywoodVintage HollywoodMilitary VeteransMilitary ServiceMilitary MenMilitary HistoryMilitary Personnel
William Holden served as a lieutenant in the US Army Air Corps during World War II.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Famous MenFamous CelebritiesFamous PeopleHollywood ActorHollywood StarsMilitary VeteransMilitary ServiceJoining The MilitaryAmerican Actors
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Once A MarineMarine MomUs Marine CorpsMarine Corps HumorMarine QuotesUsmc QuotesMilitary HumorMilitary QuotesMilitary Life
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Military HumorArmy HumorMilitary LifeMilitary BoxArmy LifeTroopsMarine CoreKnock KnockFunny Army
Smilin’ and wavin’David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Liberal HypocrisyPoliticiansLiberal LogicGun QuotesTruck QuotesLiberalismPro Gun2nd AmendmentGun Rights
Add murder by scalpel (abortions) to the tune of Almost a million per year in the US!David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Real Life HerosMemes In Real LifeReality Of LifeTruth Of LifeTrue QuotesApj QuotesMotivational QuotesInspirational QuotesFunny Quotes
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Military VeteransMilitary ServiceFamous VeteransHenry ManciniJoining The MilitaryArmed ForcesMilitary HistoryFamous MenWorld War Ii
Henry Mancini-Army Air Composer of the dreamy “Moon River” and more greatmusic.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Star Trek CharactersAmazing GiftsSideshow CollectiblesStar Wars ArtGeek CultureAsoka TanoRecommended ReadingCarrie FisherChopsticks
High end, luxury art prints from Comics, Film and more. Limited Editions and hand-signed – these make the most amazing gifts for that discerning geek in your life.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Marine Corps BasesHero’s JourneyReal HeroJanuary 26Fallen HeroesHome Of The BraveAmerican SoldiersGod Bless AmericaArmed Forces
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
2:57Lord And SaviorTrue RepentanceForgiveness In The BibleForgiveness Quotes ChristianChristian QuotesFaith QuotesLife Quotes LoveBible QuotesBiblical Quotes
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
WordPressCommon SensePro GunFreedomGun RightsGun ControlSelf Defense2nd AmendmentGuns And Ammo
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Poppies PoemVeterans Day PoppyVeterans Day ActivitiesMemorial Day ActivitiesRemembrance Day ActivitiesHoliday ActivitiesRemembrance SundayRemembrance Day QuotesThinking Day
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
I SmileMake Me SmileSincerityBelieveLook At YouAll That MattersNo Me ImportaA Good ManThis Man
This man!” It always restores my faith in humanityDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Military VeteransMilitary ServiceFamous VeteransJoining The MilitaryFamous NamesHollywood ActorOld HollywoodAmerican PresidentsActing Career
Bulldog NamesBulldog MascotBulldog PuppiesMarine MomUs Marine CorpsUs MarinesUsmcSemper FidelisWas
Bible PicturesBiblical ArtHeart Of JesusGod JesusPictures Of Jesus ChristImage JesusIn Christ AloneJesus Loves YouSon Of God
SayingsPro GunGun RightsGun ControlSelf DefenseConcealed Carry2nd AmendmentCool GunsAwesome Guns
We Are The WorldIn This WorldMake Me HappyMake Me SmileFor King And CountryJust DreamAll That MattersFunny PicturesFunny Images
American VeteransAmerican SoldiersFort BelvoirArmy HistoryBlack HistoryProsthetic LegWounded WarriorLife Goes OnHome Of The Brave
Military VeteransMilitary ServiceMilitary RanksMilitary LifeUsmcMarinesBattle Of SaipanFamous VeteransUs Marine Corps
Funny MilitaryMilitary HumourArmy HumorMarines FunnyUs MarinesMilitary PoliceArmy FunnyMilitary Salute Female Marines
https://collactiona.files.wordpress.com/2019/07
Marines FunnyUs MarinesMilitary SuitMarine BabyOnce A MarineMarines GirlfriendUs Marine CorpsMarine HumorSupport Our Troops
Sweet StoriesCute StoriesAmazing People StoriesReal HeroReal Life HerosGood PeopleFunny PeopleSpecial PeopleHuman Kindness
Motorcycle Cargo TrailerPull Behind Motorcycle TrailerMotorcycle CampingMotorcycle GarageTeardrop Trailer PlansDog TrailerCargo Trailer ConversionCafe BikeCargo Trailers
Military HomecomingNavy MilitaryMilitary SpouseDoomsday SurvivalUs Army RangersJoining The MilitaryHomecoming PicturesMarines GirlfriendNavy Air Force
Marine Corps HistoryUs Marine CorpsAmerican UniformWw1 SoldiersWwiOnce A MarineMilitary HumorMilitary HistoryUs Marines
Underground RailroadAmerican WomenAfrican American HistoryHarriet TubmanJohn TubmanGreat WomenAmazing WomenAmerican Civil WarBlack People
Military MemesFunny MilitaryMarines FunnyMilitary LifeArmy LifeMilitary ServiceMarine Corps HumorUsmc HumorDad Humor
Lee Marvin left school and joined the US Marine Corps as a sniper scout. He was wounded in action at the Battle of Saipan during WWII and was awarded the Purple Heart and discharged at the rank of Private First Class.
American History LessonsAfrican American History MonthHistory For KidsBlack History Month QuotesBlack History Month ActivitiesLife Quotes LoveWorld History ClassroomHistory TeachersWordPress
It Doesnt MatterSincerityThis Is Your LifeAll That MattersVerbatimQuotable QuotesMotivational QuotesInspirational QuotesHumorous Quotes
Bethany HamiltonSurf MarSoul SurferSurf GirlsBeach GirlsChristian InspirationSurfs UpSurfingGood People
Choppy Bob With BangsHeavy BangsShort Hair With BangsHaircuts With BangsBob HaircutsBlunt BangsBlunt FringeLong Face HaircutsShort Choppy Bobs
Missing In ActionKilled In ActionVietnam VetsSouthwest Airlines
Navajo WeavingNavajo RugsCode TalkerNavajo PeopleTaos New MexicoNavajo NationAmerican StoryLand Of EnchantmentMystery Of History
Wolf HybridFennecSpirit AnimalStuffed AnimalsSave WildlifeMundo AnimalFox AnimalFunny AnimalsAnimals And Pets
Touching StoriesSweet StoriesSad StoriesAwesome StoriesFaith In Humanity Restored MilitaryHuman KindnessUsmcGood PeopleStupid People
Superb QuotesAmazing People QuotesQuotes About Mean PeopleInspiring People QuotesBest QuotesFavorite QuotesQuotes About Ignorant PeopleTruth Quotes LifeCheap People Quotes
Wisdom QuotesQuotable QuotesConfucius QuotesPositive QuotesMotivational QuotesMe QuotesMessage QuotesLove For Child QuotesFlower Child Quotes
Speak The Truth QuotesTelling The Truth QuotesWise QuotesQuotable QuotesFool QuotesSocrates QuotesFamous QuotesTruth And LesMotivational Quotes
I Like DogsInspirierender TextDog LifeQuote PostersQuotable QuotesMotivational QuotesInspirational QuotesPositive QuotesDecir No
Military WifeMilitary HumorMilitary UniformsNavy UniformsNavy MilitaryMilitary FamiliesMilitary ServiceMilitary QuotesCoast Guard Uniforms
Be Wise QuotesBeing Smart QuotesQuotes Of WisdomInspirational And Motivational QuotesInspirational ThoughtsWiser QuotesPeople QuotesQuotable QuotesGreat Quotes
Positive quotes
WALKING WOUNDED: McCain’s torture left him disfigured and permanently disabled. He’s pictured being greeted by then-President Richard Nixon upon his release in 1973
Military VeteransMilitary ServiceFamous VeteransJoining The MilitaryFamous MenFamous FacesJanssenHollywood StarsClassic Hollywood
Christian JokesChristian Rock BandsChristian SingersChristian MusicChristian LifeJesus ArmySkillet BandJesus Loves MeGod Loves Me
John cooper (skillet) (right) and Toby Mac (left). Just wait until you see Jesus’ army.
Great QuotesWise QuotesArt Of War QuotesQuotable QuotesWisdom SayingsMotivational QuotesInsightful QuotesInspirational QuotesQuotes Pics
Any person capable of angering you becomes your aster; he can anger you only when you permit yourself to be disturbed by him.
Anthony HopkinsMilitary VeteransMilitary ServiceFamous VeteransHollywood ActorHollywood StarsClassic HollywoodOld HollywoodClassic Films
American SoldiersMilitary HistoryClassic HollywoodHollywood StarsClassic TvMilitary ServiceMilitary VeteransMilitary MenFamous Veterans
Military ServiceMilitary VeteransMilitary ArtHollywood ActorHollywood StarsClassic HollywoodFamous MenFamous PeopleFamous Faces
David Buckle https://collactiona.files.wordpress.com/2019/07/0-5.jpg
Military ServiceMilitary VeteransMilitary MenMilitary HistoryJoining The MilitaryAmerican SoldiersAmerican ActorsFamous MarinesSupport Our Troops
All That MattersFamily MattersPraise GodGodly WomanEncouragement QuotesFaith QuotesMe QuotesBible QuotesQueen Quotes
Wisdom QuotesQuotable QuotesQuotes To Live ByLife QuotesTaoism QuotesLao Tzu QuotesLong Distance LoveBien DitVerbatim
Care about what other people think and you will always be their prisoner – Lao TzuDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Military VeteransMilitary ServiceFamous VeteransJoining The MilitaryPeople Of InterestWorld War OneRed CrossMilitary HistoryArmed Forces
Military VeteransMilitary ServiceFamous VeteransCelebrities Then And NowYoung CelebritiesJoining The MilitaryVietnam War PhotosFamous MenFamous Faces
Military VeteransMilitary ServiceMilitary MenFamous VeteransBrian KeithHollywood StarsClassic HollywoodOld HollywoodHollywood Icons
Hollywood StarsClassic HollywoodOld HollywoodMilitary VeteransMilitary ServiceFamous VeteransPeople Of InterestCelebrities Then And NowFamous People
Military VeteransMilitary MenMilitary ServiceMilitary HistoryUs Coast GuardCoast Guard AcademyFamous VeteransAmerican SoldiersAmerican Veterans
Military VeteransMilitary ServiceMilitary MenMilitary HistoryFamous VeteransJoining The MilitaryCelebrities Then And NowReal HeroSupport Our Troops
Movie ShotsMoving PicturesFilm StillsCinematographyDestinAudrey TautouFrench MoviesFilm InspirationMovie Tv
Audrey Tautou in “Amelie”David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Military VeteransMilitary ServiceMilitary MenMilitary HistoryGeorge ReevesFamous VeteransHollywood ActorHollywood StarsClassic Hollywood
Military VeteransMilitary ServiceMilitary MenMilitary HistoryFamous VeteransSenate MajorityPurple HeartsSupport Our TroopsBarbers
Military ServiceMilitary VeteransAmerican SoldiersAmerican ActorsOld Movie StarsFamous MenFamous FacesHollywood StarsClassic Hollywood
Military VeteransMilitary ServiceMilitary MenMilitary HistoryFamous VeteransHollywood ActorHollywood StarsPeople Of InterestFamous Celebrities
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Actor Charles BronsonMilitary VeteransMilitary ServiceMilitary MenMilitary HistoryCelebrities Then And NowFamous CelebritiesHollywood ActorHollywood Glamour
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Wes StudiFamous VeteransCherokee LanguageAmerican SoldiersAmerican ActorsAmerican HistoryCherokee NationHal MooreIndian People
Hollywood ActorHollywood StarsMilitary VeteransMilitary ServiceMilitary HistoryWw2 HistoryPerry MasonJoining The MilitaryFamous Veterans
Military VeteransMilitary ServiceMilitary MenMilitary HistoryFamous VeteransJoining The MilitaryActors MaleDecember 26Classic Movie Stars
Military VeteransMilitary ServiceMilitary MenFamous VeteransHollywood ActorHollywood StarsClassic HollywoodJanuary 1Tv Actors
Famous MarinesMilitary VeteransMilitary ServiceFamous VeteransJoining The MilitarySupport Our TroopsAmerican SoldiersKorean WarFamous Men
Gun QuotesWise QuotesPolitical ViewsPolitical MemesPolitical EqualityGun ControlControl FreaksSubmachine GunRandom Stuff
Roy ScheiderFamous MenFamous CelebritiesFamous FacesMilitary VeteransMilitary ServiceFamous VeteransAmerican SoldiersAmerican Actors
Military PersonnelMilitary VeteransMilitary ServiceMilitary MenMilitary HistoryFamous VeteransChief Of StaffAmerican SoldiersFamous Men
Buddy HackettMilitary VeteransMilitary ServiceFamous VeteransJoining The MilitaryComedy TvAmerican SoldiersFamous MenUs Army
Military VeteransMilitary ServiceMilitary MenMilitary HistoryFamous VeteransRobert CummingsJoining The MilitaryApprisAmerican Veterans
Military VeteransMilitary ServiceMilitary MenFamous VeteransJoining The MilitaryFamous NamesWw2 HistoryReal HeroAircraft Carrier
Sherman HemsleyHollywood StarsClassic HollywoodFamous MenFamous FacesFamous VeteransMilitary ServiceMilitary VeteransBlack Actors
Military ServiceMilitary VeteransHollywood StarsOld HollywoodFamous VeteransJoining The MilitaryDavid NivenColonelFamous People
Famous MarinesMilitary ServiceMilitary VeteransHollywood ActorHollywood StarsPeople Of InterestFamous VeteransKorean WarAmerican Soldiers
SincerityFaith In GodFaith BibleChristian HumorChristian SayingsChristian FaithChristian PicsChristian CartoonsChristian Encouragement
Military VeteransMilitary ServiceMilitary MenMilitary HistoryFamous VeteransHollywood ActorHollywood StarsReal HeroSupport Our Troops
Eddie RickenbackerFighter PilotWw2 AircraftMilitary AircraftMedal Of Honor RecipientsPlane And PilotFlying AcePhoto AvionMilitary Personnel
Good QuotesFunny QuotesQuotes To Live ByMotivational QuotesLife QuotesInspirational QuotesDaily QuotesKey QuotesSerious Quotes
This set of Funny JokesDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Tennessee Ernie FordMovies PlayingBook PeopleKinds Of PeopleLiver DiseaseWorld War IiWwiiSixteen TonsMovie Stars
Sid CaesarMilitary VeteransMilitary ServiceFamous VeteransAmerican ExceptionalismOld Hollywood StarsClassic HollywoodHollywood GlamourCelebrities Then And Now
Cinematic PhotographyGreat MoviesDestinMovie ShotsFrench FilmsFilm InspirationMoving PicturesAmelie HaircutAudrey Tautou
Presidential LibrariesPresidential HistoryPresidential TriviaWorld War IWorld HistoryMilitary VeteransMilitary ServiceMilitary MenMilitary History
Gerald Ford (July 1913 – December U. President) – United States Naval Reserve Lieutenant Commander World War II combat on USS Monterey, discharged in
Real HeroAmerican SoldiersClassic HollywoodOld HollywoodHollywood StarsCaptain KangarooCat BallouAcademy Award WinnersOscar Winners
Actor Lee Marvin (left) star of “The Dirty Dozen” movie franchise. Bob Keeshan (top right) aka “Captain Kangaroo”, Mr. Rogers (bottom right). All 3 men, certified authentic war heroes. Who would’ve guessed.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Military InsigniaMilitary PersonnelMilitary VeteransMilitary ServiceFamous VeteransUs HistoryHistory FactsAmerican HistoryAmerica Civil War
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Funny Army MemesArmy HumorArmy JokesFunny JokesFunniest MemesFunny MilitaryArmy LifeMilitary LifeMilitary Style
The 13 funniest military memes of the week – We Are The MightyDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
World HistoryWorld War IiJapanese AmericanIwo JimaHistoria UniversalUnited States ArmyInteresting HistoryUs ArmyMilitary History
Ben Kuroki – became a dorsal turret gunner on a Liberator. He flew a total of 58 combat missions during World War II, and is the only Japanese-American in the United States Army Air Forces to serve in combat operations in the Pacific theaterDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Military VeteransMilitary ServiceFamous VeteransJack PalanceReal HeroAmerican SoldiersWorld HistoryWorld War IiFamous Names
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Army LifeArmy MomUs ArmyArmy GirlfriendBoyfriendI Love AmericaGod Bless AmericaNight AmericaAmerica 2
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Real HeroWorld War TwoBand Of BrothersBrothers MovieMilitary HistoryWw2 HistoryMilitary HumorMilitary VeteransMilitary Life
Band Of Brothers Hero, Darrell ‘Shifty’ Powers DiesDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Marine LoveDistance LoveLong DistanceHistorical PicturesThe Good Old DaysOur WorldVintage LoveOnce Upon A TimeWwii
Dedicated to the wonderful fashion/makeup/people/culture of the and None of the content posted on here is mine unless otherwise stated.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Bush FamilyBarbara BushUs PresidentsAmerican PresidentsAmerican HistoryGreatest PresidentsAmerican PrideNavy VeteranMilitary Veterans
#TDIH (1941) The Japanese attack #PearlHarbor. That surprise attack changed everything, of course, and many Americans rushed to enlist in the #USArmy, #USNavy, or #USMC. One of these men was #GeorgeHWBush. #WWIIDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Buddy EbsenMilitary VeteransMilitary ServiceJoining The MilitaryUs Coast GuardFamous FacesFamous MenFamous PeopleClassic Hollywood
Buddy Ebsen – Best remembered as “Jed Clampett” on TVs “The Beverly Hillbillies”. Ebsen was accepted and commissioned a Lieutenant in the Coast Guard. He served on the Navy frigate USS Pocatello, a weather ship that served on Station Able.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Military VeteransMilitary ServiceFamous VeteransFamous NamesAmerican FreedomFamous CelebritiesAmerican VeteransHollywood StarsOld Hollywood
David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Military VeteransMilitary ServiceFamous VeteransAmerican SoldiersFamous MenSecond LieutenantUs ArmyArlington VirginiaHollywood Stars
🌟Forrest Tucker / / 67 years old / Lung cancerDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg
Zazzle
https://collactiona.files.wordpress.com/2019/07/0-5.jpg
John McCain recovers from a broken leg after being shot down over Hanoi. The Hanoi Hilton’s most famous captive was probably US Senator John McCain, who was held there from after being shot down over Hanoi and hauled out of a nearby lake by an angry mob.
The president called Cindy McCain on Friday to offer her his best wishes and ask after her husband, Sen.
Vietnam HistoryVietnam WarHistory OnlinePassed AwayColonelPilotsAmerican HistoryWarUs History
Colonel George Robert Hall, a Vietnam War veteran who endured one of the longest captivities as a POW in American history, has died after he lost his
Vietnam VeteransUsmcMilitary HistoryWorld War IiWar ImageBattle Of Hamburger HillNorth VietnamParatrooperAmerican History
May A Shau Valley, South Vietnam. Medics rush an injured paratrooper to an evacuation helicopter during fighting on ‘Hamburger Hill’ in the Vietnam War. Image by © Bettmann/CORBIS
Military HumorMilitary GearMilitary VeteransMilitary ServiceVeteran HatsVietnam VetsUs VetsAmerican SoldiersUsmc
Gift ideas: Vietnam Veteran caps ,I want this cap.
ACTION, NOT words. https://onlizinenet.blog/2019/10/28/our-military-still-paying-the-price
and how
Each day you can journey from your Alpha (it begins with you) to your Omega, which in the teachings of Pierre Teilhard de Chardin, is the point within each of us where our inner spiritual nature meets our outer worldly nature. It is with this thought I bring to you daily dose of affirmations for […]
Daily Dose of Inspiration — Be Inspired..!!
a fallen American, he did, so we all can avoid such occurrence personal like…
to be suggested, not forced, yet disabled from seeing amusing images all in
computerized, falsified. 1’s and 0’s, conversion to digital entity, from the living ‘n’
breathing human; well as got something to say, even if it is. a sort of banter
that ‘control’ considers rebellious, my mind creates incidences; a cause and effect
stream of literary shouting, only this time not all capitalized, and that, does
feel like the lower case letters to be much more emotive, not so rigid and all ‘so to
be’ regarded more… much more , but that’s a tangent not to be developed.
https://www.youtube.com/channel/UCVW-2rLA1wXXr32fmeF3bHg/discussion
something that is evolving as we type… http://www.carolinatheatreclt.org/theatre/history
https://wordpress.com/read/blogs/158915175/posts/3174#comments
Discussion on The https://www.pinterest.com/davejbuc3 don’t look
David 2 days ago https://en.gravatar.com/davidb48 – https://www.youtube.com/watch?v=M_Q6ZSzV8iQ –
https://wordpress.com/block-editor/post/the3rdonlive.wordpress.com/2200
wordpress.com/block-editor/post/the3rdonlive.wordpress.com/1874
well, not going to soil this immediate mind by reading other’s additions,
youth will be the future; IF they understand that said future is their future
they might consider reality, not the boob-tube’s media folly. the effort to
change the current power that is will only arrive with inexperienced vote.
young opinions are marked with an almost deadly self opinion. think of it
from those who have been there before in a not so similar situation, but it
just doesn’t matter. socialism generates sadness, more as it morphs into
communism. socialism is communism with Christmas lights. it may seem
so innocent, presents in view, but nothing, but nothing’s free on this globe.
the piper WILL be paid. think of the things you will lose, with that free
ride they like to voice to the uninformed, are full of energy for a personal
assumed gift. that gift will cost in the future, maybe not in the short sight,
but believe it. it will come from the rear. biting every liberty and freedom you
think will last forever. hint: nothing lasts forever; barring the Word of God. dig it.
let us not remember, and spout out, history. it’s bunk, nice to recall, but not to return. DO NOW.
actions, not words…
the future is owned by the youth of America. said group of citizens be seeing all
the joys you experience now. that free ride will cost you young adults your future.
Edit
View in discussion
Discussion on
About Jesus.net
7 comments
David 2 days ago Edit View in discussion David 2 days ago
Gentle Touch
Inboxx
Jose San Martin 9:01 PM (20 minutes ago)
to HGT
Daily Lesson
Consider the advice of your elders not
because they are always right but because
of the wisdom they have gleaned from
being wrong…Native American quote
As you look back on your younger years
the number of times you thought your
parents were wrong are now echos that
you hear when you try to tell your
children what to do. Remember, you are
never too old to learn from someone even
a few days older than you and never so
old you can not teach someone a few
days younger.
Edit
View in discussion
David
6 days ago
worldwide posting, no cost, only encouragement would be realizing how
late it really is to NOT believe. you will not lose if “TO” is your decision…
https://en.gravatar.com/dav… – https://wordpress.com/view/… Edit View in discussion David 7 days ago
glad to be back ya’ll!
https://jesus.net
https://collactiona.live
Edit
View in discussion
David
5 months ago
https://dailyps.com/conside… as a doornail. View in discussion Discussion on newsCafe 41 comments
David 6 days ago Pending
Trump 2020 – otherwise we’re headed for socialism;
which IS communism with out Christmas decortuion
Discussion on
About Jesus.net
3 comments
https://the3rdonlive.wordpress.com/ Edit View in discussion Discussion on Brighteon.com 1 comments
the views and the opinions expressed in
https://collactiona.live/o9d DO represent
the views/ideas/beliefs of David Buckle… View in discussion Discussion on About Jesus.net 4 comments
DavidCharlotte Christine Roman 5 months ago as am i View in discussion Discussion on Dailyps 8 comments
Make the most of every opportunity for doing good in these evil days. — Ephesians 5:16
We must buy up the opportunities we have before the night comes. This is the day of opportunity. Our church took a survey of two thousand women in our community to find out what they were thinking, and how our women’s ministry could best meet their needs. Out of all of those interviewed, only a handful of women were hostile or refused to talk with us. We need to buy up the opportunities with the many who are interested and searching.
Colossians 4:5 tells us to “live wisely among those who are not Christians, and make the most of every opportunity.” Paul goes on to explain that in this wise walk, our speech must be salty (there will be a tang to it) so that we may know how to answer every person. Making the most of every opportunity means cultivating the “know-how” of argument and debate. Making the most of every opportunity means that by our very lifestyle, we will engender some questions from others.
Once in a train full of rowdy, drunken football fans, a young Christian was sitting quietly, reading. An old gentleman, observing first the drunks and then the young man, said to him, “You seem to have found the secret to life—do you want to share it?” Our young friend lost no time “making the most of the opportunity”!
We must ask God for a great sense of urgency so that we can make the most of every opportunity to serve and share him.
For further study: Ephesians 5:15-20
He does the picking and choosing; maybe ones character and behavior matter.
https://the3rdonlive.wordpress.com/2019/10/22/1933
could be, should be, so it is now :.)
saved to be secure in life, know there is more than meets the eye
https://www.youtube.com/user/Godiswithusfull TRUST GOD ALWAYS
% God Does Not Want You To Try Harder, He Wants You To Trust Him %
thank you; much.
To those who know Me not, there is in Me nothing to appeal to them, or to attract them.
Those who know Me there is nothing more to be desired.
“No beauty they could desire Him.”
Oh! My children, draw very near to Me. See Me as I really am,
that ever you may have the Joy of finding in Me all you could desire.
The fulfillment of all you could desire in Master, Lord, or Friend.
such is the this case here, my friend, ‘m not upset…
All Are called… few RSVP, huh?
sadness…
For many years, Silicon Valley parents (aka tech inventors) have been sending their kids to private low-tech schools and limiting their use of tech, whereas other American families are being told that providing “high tech” educations is what’s best for their kids. An increasing number of experts and studies continue to warn that this is definitely NOT best for kids (see 1, 2, 3), and it’s not just about eye damage (see 1, 2) from excessive screen use.
When students at a private school in Australia were given a choice between a high-tech education or no-tech education, they chose no-tech. When American families aren’t given a choice, some are removing their kids from schools. From The New York Times:
The seed of rebellion was planted in classrooms. It grew in kitchens and living rooms, in conversations between students and their parents.
It culminated when Collin Winter, 14, an eighth grader in McPherson, Kan., joined a classroom walkout in January. In the nearby town of Wellington, high schoolers staged a sit-in. Their parents organized in living rooms, at churches and in the back of machine repair shops. They showed up en masse to school board meetings. In neighborhoods with no political yard signs, homemade signs with dark red slash marks suddenly popped up.
Silicon Valley had come to small-town Kansas schools — and it was not going well.
“I want to just take my Chromebook back and tell them I’m not doing it anymore,” said Kallee Forslund, 16, a 10th grader in Wellington.
Eight months earlier, public schools near Wichita had rolled out a web-based platform and curriculum from Summit Learning. The Silicon Valley-based program promotes an educational approach called “personalized learning,” which uses online tools to customize education. The platform that Summit provides was developed by Facebook engineers. It is funded by Mark Zuckerberg, Facebook’s chief executive, and his wife, Priscilla Chan, a pediatrician.
[…]
Then, students started coming home with headaches and hand cramps. Some said they felt more anxious. One child began having a recurrence of seizures. Another asked to bring her dad’s hunting earmuffs to class to block out classmates because work was now done largely alone.
“We’re allowing the computers to teach and the kids all looked like zombies,” said Tyson Koenig, a factory supervisor in McPherson, who visited his son’s fourth-grade class. In October, he pulled the 10-year-old out of the school.
In a school district survey of McPherson middle school parents released this month, 77 percent of respondents said they preferred their child not be in a classroom that uses Summit. More than 80 percent said their children had expressed concerns about the platform.
The resistance in Kansas is part of mounting nationwide opposition to Summit
[…]
Parents of special-needs students noticed problems immediately. Amy Jackson, a night-shift nurse in Wellington, has a daughter, Megan, 12, who has epilepsy and whose neurologist recommended she limit screen time to 30 minutes a day to reduce seizures. Since the school started using Summit, Megan has had seizures multiple times a day.
[…]
Some parents said they worried about their children’s data privacy.
| https://www.pinterest.com/davejbuc3 |
| My Mercies are great to all who turn to Me and to all who turn from me. How tenderly I yearn over these wayward ones. How I seek ever to save them from the hurts their very refusal of Me will bring upon them. I long to save them from the hunger of loneliness that will follow their driving away the only love that will satisfy. www.pinterest.com/davejbuc3/truth-as-we-age-it-becomes-clearer it’s 12:00PM, smile, you made it this far, don’t quit, it will make you sorry, believe you me. take it from one who has been there before. oh, and by the way, what it’s for AND about is Him, God. |
https://wordpress.com/view/the3rdonlive.wordpress.com https://www.youtube.com/watch?v=yqw9zlK-un0 – https://wordpress.com/view/the3rdonlive.wordpress.com https://www.youtube.com/watch?v=oHfNY3Ufl88 https://www.youtube.com/watch?v=aI7fe5FsgJg
ONCE AND FOR ALL, I AM NOT GOING TO TOLERATE BEING PINNED AS non hetero.
thank you. May God have mercy on your souls.
The moment we recognize our complete weakness and our complete dependence on Him will be the very moment that the Spirit of God will exhibit His power.
– Oswald Chambers –
https://www.youtube.com/watch?v=x6csBPYfOH8 https://the3rdonlive.wordpress.com/2019/08/23/if-you-only-believe-anything-is-possible-for-those-who-believe
I am among you as one that serveth.
Yes! remember to serve all. Be ready
to prove your Sonship by service. Look
on all you meet as guests in your Father’s
House, to be treated with Love, all consideration, with gentleness.
As a servant of all think no work beneath you. Be ever ready to do
all you can for others. Serve. Serve. Serve. There is a gladness in
service, a Joy in doing My Will for others, in being My expression
of all good for them.
Remember that, when you serve others, you are acting for your
Master and Lord who washed His disciples’ feet. So, in service
Efor others, express your Love for Me.
Daily Lesson
The question is not what you will do to get what you want or where you want to be. The question is what are you willing to give up? Nothing in this world is free, everything cost, money, time, or love. The three most important things in our lives. What are you willing to give up for this world, for the spiritual?
If the message in the Daily Life Lesson is not clear,
please feel free to ask for clarification or if youwish to submit a Daily Lesson please contact mehisgentletouch@gmail.com
https://wordpress.com/read/blogs/164027947/posts/1472
…. https://the3rdonlive.wordpress.com/2019/09/18/801 ….
During our times of becoming or being emotionally and mentally tired, we often focus on how to revenge ourselves from those who come after us with evil intentions. This is not the proper way in how we should handle what looks like to many of our defeat. We should never ask our FATHER in the name of JESUS to bring about harm or to quote back to HIM this scripture, [vengeance is MINE, said the LORD].
Before the crucifixion of JESUS CHRIST, those prayers that we find in the Old Testament would have been sufficient. But after the crucifixion of JESUS CHRIST, they no longer are. During the time when JESUS CHRIST walked among HIS creations, mankind. JESUS spoke and taught about being loving even to those who will come against us.
Nehemiah 4:4 Our FATHER can see clearly that the loads that we are carrying because we have not taken them to HIM, has caused us to become mentally and physically weaken, that our strength is about to fail.
Our FATHER has mercy for us, we have HIS loving-kindness, we have HIS pity. HE is not blind, HE does not turn HIS head to keep from looking at us. HE is aware that some of us are filled up with the contempt and pride of others. They ridicule us because they are arrogant and prideful. The problem is that some of us are not aware of these facts. And because of our ignorance of these facts, we do not live our lives knowing that our FATHER provides us with HIS grace because we are afflicted and humble.
LET US GET IT FINISHED; AS JESUS CHRIST/GOD FINISHED IT; YET THIS BIGGEST TRUTH; IS ABOUT AN INFERENCE TO WHO, NOT WHAT, IS THE RULER OF MY HEART, THE WORLD TO COME: HEAVEN, THE ETERNAL GIFT. A HOME FOR ALL WHO DILIGENTLY SEEK HIM, NOT him
_ Elohim (Hebrew: אֱלֹהִים [ʔɛloːˈHim’]) is The Word, The Word was God, and The Word is God. _
| Jose San Martin | Tue, Sep 24, 9:00 PM (3 hours ago) |
Daily Lesson
A house is made of bricks and wood.
A home is made of love. Let love be in
every room and in the hearts of all that
live there. Let it spread to everyone you
meet one by one and perhaps one day we
will have the world that the Lord intended.
Lord, watch over those I love, remind them
they do not walk alone and guide them with
Your gentle touch. All things work together for good, for them that love the Lord. even the tragic event whereupon this sinner was spared from the end deserved. thank God.
If the message in the Daily Life Lesson is not clear,
please feel free to ask for clarification or if you wish to submit a Daily Lesson please contact me: hisgentletouch@gmail.comt
https://the3rdonlive.wordpress.com/2019/09/25/1441
iT’S WHAT COULD BE DONE, SO THIS IS. I AM FOR
HIM WORKING ,TO ASSIST THE ONLY POWER THAT
KEPT ME ALIVE; AS TO REACH THIS POINT IN LIFE.
i am not afraid to trust in The Holy Spirit. regardless of the recent statements of “i”, and it seeming vain and self-serving, let me assure you: Such is in no way factual, i work for Him.
a sort of enthused effort to garner past viewers to come back.
and that being said all are encouraged to visit our sight on all remembered revisiting – there will be no ‘newer’ posts as of a few days ago. we had attempted to gain followers as nest as a wholesome ingredient provider can/could. all lurid posts, the mass of web-traffic seem to go the easy r0ute: seks, dogas & free stuff… “THERE ‘AIN’T NOTHING FREE, AND TOO DAMN LITTLE FOR A BUCK ANYMORE.” – well, there ya have it: the world is all consumed with the god of the air. it’s plan is for to do as you will, forgetting deserved ramifications. to those it is responded with displeasure coupled with pleasure; see… a sinful character are always welcome in Jesus’ corner, just as you are; no past behavior will be remembered, providing a sinners regret/faith is genuine. all are welcome. there is not a ticket, or ANY ‘price’ required. come as you are; He will not be fooled. GO AHEAD TRY. do enjoy His bigmercy to all.
.-.-.-.-. https://wordpress.com/block-editor/post/collactiona.live/2068 .-.-.-.-.
Mark Armstrong, The WordPress.com Blog
Mar 25, 2019
Electric Literature Moves to WordPress — Here’s How an Indie Publisher Thrives on the Open Web
Electric Literature launched 10 years ago in Brooklyn, New York, as a quarterly print journal with a mission to make literature more relevant, exciting, and inclusive. And today they’re celebrating the launch of a new website on WordPress, at electricliterature.com.
Surviving (and thriving) for ten years as an independent publisher is no small feat. Over the years the nonprofit organization has grown its online audience — with offerings like Recommended Reading and The Commuter — while expanding its membership of readers who help fund its work. The website is free to everyone and relies on the generosity of its community to donate to the site and support its mission.
How does an indie website make its business work in 2019? We talked with Electric Lit’s Executive Director Halimah Marcus about some of the lessons they’ve learned in the past 10 years.
Slow and Steady Growth Can Be a Very Good Thing Focus On Your Mission.
chineloanikpeogechukwugmailcom
Ihagh G. T.
Mar 25, 2019
👍👍👍… inspiring post, especially the longevity,10 years, which includes some other ingredients…I can see a lesson for passionate site owners: their peers ending business, especially when the initial dream was to stay in business without ever leaving. What might have halted them? Well, that would be a story for another day.
Certainly, longevity will bring about many many subscribers/membership. passionate people already have passion, so the watchwords I can perceive from your post are: “persistence, positivity and patience,” we will get there.
overbee
Mar 26, 2019
Your mission is a very important one! Keep up the great work and thank you for the inspiration.
Sarahmente
Mar 26, 2019
It’s fantastic to read that Electric Literature has been so successful while remaining true to its mission. A real inspiration to us all.
15Likes
Comments closed.
Child Of God, From The Darkness Into The Light
Dec 15, 2018
SOME OF THE POSTS DO NOT REFLECT ALL I BELIEVE IN BUT IN MOST PART THEY REFLECT MY VIEWS. MY TEACHER HIS THE HOLY SPIRIT. excellent, the best lessons are yet to come
Jonathan Caswell
Dec 18, 2018
obedience is better than sacrifice saith the Lord – HOW SO!
www.pinterest.com/davejbuc3/be-secure-in-life-know-there-is-more-than-meets-th/
Barry – Innerman
Feb 22, 2019
you are indeed a vey wonderful, and powerful woman the Lord is your strength Child Of God
Barry – Innerman
Feb 22, 2019
Thank you, God IS good
David Buckle
Cheri Lucas Rowlands, Discover
Jan 15, 2019
What Would You Do If You Could Do Anything?
What would you do if you could do anything? Tell us in the comments or in a new post.
siusanwbrownCJTCHBHeather’s Blog Spacetanishq Guptachristopherhull8442Esculenta officinalissimplyvaishvhandemaala
Load previous comments from vhandemaala and others
r3alizationz
Jan 22, 2019
If I could do anything, I would start a group of orphanages, schools, and shelters for children. All over the world.
Lexygirl Lessons: Requited Therapy
Jan 22, 2019
I would do therapy sessions in a different approach rather than the traditional red tape one. Maybe have a session with client while watching across the beach or a coffee shop rather than dreary clinic
12Likes
kennynines
kennynines
Jan 22, 2019
I would write a song, one that would fill hearts with joy and inspire people to share that joy with everyone. I would play it in coffee shops and bars for coffee and beer. I would release it directly into the public domain so anyone could play it anywhere, and the only thing I would really want from it would be to be remembered after I am gone.
Read More15Likes
Comments closed.
gthielges, gwenthielges.com
Nov 24, 2018
Just Like Joshua
Parents often repeat commands to their children for emphasis. In the first chapter of Joshua, he was told by God to “Be strong and courageous,” three times. God’s words in these verses seem to be a very matter-of-fact way of informing a willing man that the next steps must be taken, and success would not be a part of the equation if strength and courage were absent. The next steps were to obtain the land promised to the Israelites.
God’s marching orders held no promise that a supernatural feeling of courage would well up inside of Joshua’s soul. Nope. No “peace that passes understanding” feeling would signify it was time for Joshua to move. The words feel or feelings do not make an appearance in this chapter. God did not tell Joshua to feel strong and courageous. God told Joshua to be strong and courageous.
Did God promise His presence? Absolutely! But there was no promise that Joshua would not necessarily be shaking in his sandals as he carried out these sacred steps.
TerigthielgesDonna MillerSheri Traxlersusanslandry
Load previous comments from susanslandry and others
Healthy Living Mom
Healthy Living Mom
Nov 28, 2018
Thank you, Gwen, for this encouragement from Joshua. I’ve been camping out in this book for a couple of months and your words are timely. Especially, ” Courage is the strength to keep repeating to ourselves until we believe it that, “God is with me.” Thank you so much!
Healthy Living Mom
Nov 28, 2018
Thank you,
I appreciate your encouraging words! God is surely with us at all times!
Dec 6, 2018
When we rely on God’s courage and confidence,
we can accomplish anything
susan home schooling
Dec 20, 2018
So very true! Thanks for your comment!
path of life devotions, The Path of Life Daily Devotions
Jul 26, 2019
July 26, “Good”
In life there is doing “good” and being good; these things are not always found together.
A songwriter can write a good song without being a good person. A good person may be totally unable to write a good song. Go figure. Good works and goodness are not always companions.
“What Must I Do?”
Tradition calls him, “The Rich Young Ruler.” He had it all (to his way of thinking) but somewhere inside there was a void possessions and position and power did not fill. So He came to Jesus with this question:
“Good Teacher, what shall I do to inherit eternal life?”
Riverside Peace
Riverside Peace
Jul 26, 2018
Great message.
Love the song “God is so good”
Thanks for sharing
path of life devotions
Riverside Peace
Jul 26, 2018
Amen. Such a simple song with such a profound truth, Thanks for reading!
Steve
Riverside Peace
path of life devotions
Jul 26, 2018
Your welcome. I make it a habit not to ‘like’ unless I do read. If I love it, I will comment too. Have a great day.
ReplyLike
pathoflifedevotions
pathoflifedevotions
Jul 26, 2018
Means so much!
Steve
ReplyLike
David Buckle
Enter your comment here…
SEND
glastonburyeagle, We Write to Be Human
Jun 11, 2012
David
Jun 7, 2019
edharris8
edharris8
Oct 15, 2015
Might need to update your Bio…;-)
Right Now Counts Forever
the presence of Christ.
COLLACTION
Jun 24, 2019
must be,
and how exciting!
\o/
David Buckle’s, COLLACTION
Jul 6, 2019
Life’s storms
sweet barbershop? caN YOU DIG THIS? – https://youtu.be/oL1JyDTq3Qc
www.pinterest.com/davejbuc3/boards
wanna mug? https://wordpress.com/read/blogs/152707401/posts/374
see, this WHOLE EPISODE WAS THE INTENDED,recall how we figured,
| Jose San Martin | Wed, Sep 25, 9:00 PM (12 hours ago) |
you of all, took me seriously; asked how and the answer was rough?
Thank You!
Daily Lesson
The light has faded into darkness.
I have lost my way. My tears are like
the falling rain. I have lost my way.
all know someone who has, yet we
ignore them and do not reach out.
A smile, a kind word, or a helping
hand might save not only a life but a soul.
like i said: Katie’s brother kinda figured, but he was a senior; not fish friends. recall?
wordpress.com/block-editor/post/the3rdonlive.wordpress.com/1441
God help us if some yahoo’s placed in Trump’s seat, only God knows what the future. heard today’s gossip in Charlotte: “they’ll br a huge exodus from the United States if Trump loses.”
what’ll occur to this nation IF some wimpy guy, who does not know shit
check from all: us taxpayers, the less significant party hope to interrupt a businessmaster’s method of getting stuff done withOUT his commonsense notions; all except their own greed, and ambition concerned strictly their own selves. OUIR NATION is no democracy at the moment, it isn’t even a republic
when asked by a man: what sort government that the constitutional convention had formulated for the new nation, Benjamin Franklin did memorably reply: “A republic, if you can keep it”
about howto get things done… all the guppies who slid into a sweet pay
hoping to not live in a nation where the ru.ing party forgets Veterans, Social Security (justice), the rule of law. go trump; U.S.’ll be very sorry he doesn’t win.
that’s it, you need to go through the valley, just don’t stay in it.
http://www.the3rdonlive.wordpress.com
i‘swhat i can do, so i do. don’t worry
about a thing it’s going to be okay…
social media does younger kids no good, ifn’ they do not have the wisdom to peer at images and not be affected, and do not avoid such stuff. our lives are so perfidious and this country’s morals are seriously out of wack, so agreeable to eyes that are continually seeking information. interest are a good attribute for kids and teens. this world we all live in is a wondrous; yet the advertising is… well, you figure it out. once an picture gets more than a glance it is in their malleable minds.
you know when stuff goes bad and falls all apart? you do not understand why this happened not that; like: you really want something for your birthday, or whatever, dudn’t matter… anyway, feel like you’d do anything to get that Christmas gift? and don’t find it under the tree that morning? you know what you call that? we call that life; get used to it. down here we suffer, we can look above; and aim in that direction; for that is where some will be; like forever, singing all the day long thanking Him for including us regular souls that at times are acting in a sinful nature. God knew that we will have those notions to act outside the will of God, yet that is the whole reason for His cross, Jesus Christ goes in our place to suffer the punishment we all deserve.
it’ll fill our minds, in the valley… get that SPRING of the valley.
