Featured

8-12-2020 3:25.57 PM

DEMONCRAPS

We, as American
citizen’s were told
and expected that;
almost commanded
to FIGHT, DESTROY,
all, NOT some but all
enemies, foreign and
DomestiC. George did
have a European sense
of humor, did he not? si’

PRAY THAT WHEN REAL STUFF BEGINS OCCURRING; CHRIST WILL COME FOR US.

https full movie: BillyJack Vietnam Vets

draft dodgers be damned

https://disqus.com/home/forum/aboutjesusnet Whoever snuck that ‘s’ in fastfood was clever.

Lord, We thank you for this day, where suggesting may go public: FIGHT he that hates U.S.

www.flickr.com/photos/davesuptown The Book of Enoch It is God’s timepiece. Not ours

https://www.pinterest.com/shepherdschapelcom/ncl/the-game-marriage-is-serious-not-sex

https://collactiona.live/2020/08/10/5432 War is hell, Americans: see Iraq Fatalities: 4900

Forgive U.S. that which we have done wrong; guide U.S. plz.

He is everywhere

One evening while sitting at home a had a very strong feeling that I should call an old friend that I had lost touch with. It was late in the evening and her number was in an old file at work. The feeling was so strong that I went to the office, found her number and called her. She was at the point of tears, she told me that the she was scheduled for an operation early the next day. She had to decide on one of two procedures. The safer one would mean cause a life change, the more dangerous one would allow her to lead a normal life if successful. Her family was there with her and all were urging her to have the safer procedure. She asked for my advise, I though for a while and answered that she should go with what her heart told her to do. She wanted the more dangerous procedure and after a few minutes, I told her that I had this very strong feeling that I had to talk to her that very moment and that I felt that it was so that I could support her in her choice. Had she being crying out to me, or was it a gentle touch that my help was needed. She had the more dangerous procedure, everything turned for the best.

PANDEMIC THE UNITED STATES IS INSIDE NOW DOES NOT ERASE GOD’S PROMISES

LALANIA! THANK YOU!

belief is required, know someone does not know the help us in going though the world, the humankind that regards Angels as hooey. The helper has not only come to us; hopefully you will respect this is fol-

lowing His Truth. There’s no thing but joy awaiting everyone.

The Holy Spirit is working in every life; sad so few find His Love.

Some may need to have His reality come into you through tragedy.

Pray more. Hearing these words are a good beginning of a true faith.

Excuse me, PatrizeA

see you there

Featured

Jesus Christ be glorified

God Calling – Empty Yourself

Psalm 4:8  
Rely on Me alone.
Ask no other help.
Pay all out in the Spirit of trust that more will come
to meet your supply. Empty your vessels quickly; ensure
Divine Supply. So much retained by you, so much the less will
be gained from Me.

It is a Law of Divine Supply. 8-10-20 AD 2:34/34
To hold back, to retain, implies a fear of the future, a want of trust in Me.
When you ask Me to save you from the sea of poverty and difficulty you must
trust wholly to Me.  If you do not, your prayer and faith are genuine, then I must
first answer your prayer for help as a rescuer does that of a drowning man who is struggling to save himself. He renders him still more helpless and powerless until he is wholly at the will and mercy of the rescuer.  So understand My leading. 

Trust wholly. Trust completely. Empty your vessel.  I will fill it.  You ask both of you to understand Divine Supply. It is a most difficult lesson for My children to learn.  So dependent have they become material supply they fail to understand.  We
must live as I tell you. Depend on Me. Now unto Him who is able to keep you from stumbling, to make you stand in the presence of His glory blameless with great joy, to the only God our Savior, through

Jesus Christ

our Lord,
be glory,
majesty,
dominion,
authority,
before all
time and
forever. __________   Amen.    Jude 1:24-25
https://davidb49.blog
sort of disclaimer? well, that isn’t the correct term actually, because this is no ‘dis’ any claim: BUT there is no doubting a continued presidency, we, i think. the thing about not mixing government and religion is bunk; tell that to our first praying president: George Washington. praying is needed for all Americans; those that do not are doing these United States a disservice.
God Loves You

Man cries for help. Man feels his need of Me.

All unmindful that countless times I draw near

unheard, pass on unnoticed, speak to deaf ears,

touch brows fretted and wrinkled by earth’s cares.

“The Christ is dead,” man says.

Alive and longing, full of a living tenderness I passed

his way today. He heeded not.

Man hears the storms, the wind, the earthquake, and his

ears still pulsing with the echoes he hears no Still a Small

Voice. Oh, do not miss Me, My children.

Featured

pleAse be calm

Thank God,
and trust Him;
that is all we can
do. We’re ion God‘s
control. Sin gets us at
times. sometimes we go
and try to be self righteous;
If there’s no resurrection, there
is no hope. BUT, He is with us all. TAKE THIS FIRST STEP. thank you.

at times truth arrives from a more odd path
www.youtube.com/watch?v=YH0eHzTKEMY\
or not, but be aware, please?
California, do be aware
First Century Youth Ministry 12-14- 2019 God-will-provide

https://wordpress.com/view/collactiona.live

https://youtu.be/Hj_hyBEgOJ0

https://youtu.be/LgXt9YVr94U

https://the3rdonlive.wordpress.com/2019/10/22/1933
could be, shou=ld be, so it is now :.)
saved to be secure in life, do know there is more than meets the eye.
https://www.youtube.com/user/Godiswithusfull TRUST GOD ALWAYS

% God Does Not Want You To Try Harder, He Wants You To Trust Him

Google.app/JB – THANK YOU

Featured

we plug

“It sounds implausible, but that’s how Into That Good Night, the modest but powerful new book by 46-year-old Lake Jackson resident Ron Rozelle, came to be published this August by Farrar, Straus, and Giroux, the home of such esteemed authors as Susan Sontag and Tom Wolfe. Ethan Nosowsky, Ron Rozelle’s editor, says it has been five years since the company last published a manuscript that came in over the transom. He had been “delighted and surprised,” he said, when he looked at the first two chapters of Into That Good Night. “Am I hallucinating?” he asked himself. When he read on, he says, he was “overtaken by the strength and the vision” of the book.”

sounds good to me. Mr. Ron Rozelle became my favorite teacher throughout a four years of Joy-tour: replete con wisdom shared by Mr. Herbert Torres, Mr. Rozelle and Mr. Bill Gottschalk, the conductor of my junior year band. His wife, Sue Gottschalk conducted that initial band, was in Lake Jackson Intermediate 7th and 8th grade. She plays a mean Bach Coronet, silver. She took me into her office one day in the noon hour to confirm that the similar Christianity benefit that fell on me, a rascal of a horn player, but also a Christ believer since my days in a little town named Oxford, Alabama. Baptized into that Episcopalian faith in 1973, David found such joy with the simple things in those days of my third year alive. As the cool concrete, a smoother type as apposed to the sand-papery texture of driveways, beside the bare stomach which was my usual dress in those hot summer days – where was i? uh.. this memory is only handicapped by the head injury ‘m blessed to have endured in 1992, do me a solid by excusing my confusing banter; see: am very able to recall those difficulties that were David’s life lessons to create the not so wise goof he portrays. the nutty thinker enduring a few disability’s back where he was born, and lived in three different times – ’70-’72, ’80-’83, and 1992… now, and for good. settled down, but have not raised a child; yet.

yes we do: see?

stuff we’ve purchased and do their job’s all’s well.

products, businesses, mood enhancers, smile

maker’s, the economical purchased business.

all we are doing, did is to display, an thing; in

relation to what you have is completely up to

YOU. Joy

Winston Salem, see, and hear this for your own sake and future. please

Great Album
biggest inspiration
When Jesus was walking down this way on earth…
certain solution : stop doing ; yourself , like ? yesterday .
True Stories (film)

Featured

now’s the time?

hope is strong… so that it doesn’t require the world’s proofing, faith is all that matters.

the younger generation feels entitled, we fear, to be coddled and taken care of. without

realizing most don’t understand what our forefathers died for. that was the aim of naming

the musical conglomeration that David assured most of the student body that Brazoswood

high school that would be an attempt when David got out into the real world, all away from

that rightfully governed, BUT lenient, environment that was education in the state of Texas.

Texas was, and is now; that coinciding with their squashing a completely evil common core

sttyle of educating a state’s youth. but there i go assuming; but that assumption is coupled

with, though it’s been over twenty-eight years since living in that wonder of independence,

that super stolid states. in the better sense of that word; no thing changes very much in TX

due to it’s deeper root’s of independence of all fifty. a matter of fact: the state’s reputation

of gun ownership is more of a barbed wire fence than a hoping of any ‘wall’ that’s in itself

an incredible concept. we hope it provides the slam on drug-trafficking that it’s use is for.

Drugs are the scourge of our nation. LAZINESS is so expounded upon by so much more

slack (lazy behavior) that ruins the walk in holiness God does not command, but He is

recommending said behavior. Yaweh did not emphasize said choice. we, as believers

are instructed to /Thessalonianns 4:13-18\ – “For we say unto you, The Word of The Lord,

that we which are alive and remain unto the coming of the Lord, shall not prevent

all of them which are asleep.’ ‘For the Lord Himself will descend from Heaven with

a shout, with the voice of the archangel. And with the trump of God: and the dead

in Christ shall rise first: ‘dead in Christ – relatives, Parent’s, THEIR Parents are all

ready there.’ ‘In an instant, at the last trump, only the last trump does the change

we alive in Christ will see Him return to this earth, and not until. THEN we which

which are alive and remain shall be caught up together with them in the clouds,

to meet the Lord in the air: and so shall we ever be with the Lord. And He will

be here, on earth forever.’ Our spirit bodies, our breath (Pneuma) a spirit body

or the breath of Life that God breathed into each of our body’s at the tail end

of our physical birth. In an instant in First Corinthians Verse 52, 53, and 54.

Instantly we are changed into that incorruptible body. Paul spends half of

the chapter teaching that we should not be ignorant, of the two body’s of

man. The dualism: The flesh body; the spiritual body. Verse 18, therefor

comfort one another with these words of comfort that Paul explains of

the return of Christ. God‘s elect, as it is written in Mark 13 will stand

against the false messiah. When He returns at the seventh trump…

it is recommended we

seek out original texts

in the Greek and Hebrew:

Strong’s Concordance

¿

Pastor Murray

“Never expect God to do for you what you do not do for others…” Bob Marley
For so many, life is a one way street in their direction.  They see so much that can be done and chose to ignore it.  Sadly, it takes so little effort to do a good deed that might change someone’s life forever.  Some might stop asking God for what you want; and ask for those less fortunate than yourself.

Featured

this just in,

pray for astronauts about to re-enter earth’s atmosphere.

are a few more Angel’s in Heaven today

Regis Philbin passed away

He Finished His Race

arghhh…

oo

o

OO

He that reapeth receives wage, gathereth fruit unto life everlasting,

that both he that reapeth and he that soweth may rejoice together.

Do you not see that if you are careless about the reaping you have prevented the

harvest-joy of the sower?

If by your life and character you do not reap to the full that which they have sown,

you are robbing them of the well-earned fruit of their labors.

Further learn this lesson. There are many; My workers and servants in different

spheres of the activity to whom you owe the seed: word or example, loving help

that has influenced you. It is a sacred trust. Use it fully.

Featured

Cross over

https://www.youtube.com/watch?v=rl9PJqjYink

the3rdonlive/2020/07/19

now what?

murderers will burn, He says so
Stay with Him; spoiler alert: He wins.

Pay attention: we are ALL suggested (for OUR OWN LIBERTY) to DEFEND OUR American Constitution against all enemies, both foreign and DomestiC, hmmm

https://onlizinenet.blog/2019/05/31/us-among-equal-go-love-jesus

Or catch the bug that’s going around everywhere, and end up dead. your choice. get drunk, be high, get laid; go’n die. socialism is communism in diapers, young folk you know this! # thou shalt not ABORSHUN IS SO WRONG! 1989-1990 11:59.59

My SitesReaderWrite

Visit Site (opens in a new tab) porch of the lord The Porch of the Lord ~ 266 followers

Cross Over to the Other Side

A cross on a hillside beckons for our attention, it can bring to mind something that Jesus Christ. A cross on a hillside beckons for our attention, it can bring to mind something that Jesus Christ mentioned when He and His disciples launched out for a sail.

Let’s cross over to the other side,” were His words that didn’t fail.

Have you been on the side; those who have apprehensions,
to reject that Christ is Lord or doubt God’s intentions?
Look thoughtfully to the cross, for a strong message it bears–
God wants you to cross over to knowing that He cares.

Any other “religion” hasn’t the cross’s personal touch–
God sent His Son to die for you because He loved you that much.
There, Jesus made the sacrifice for your well-being and sins,
so you could cross to the place where new life in Him begins.

Despite a storm, His words didn’t fail in that Biblical account recorded.
They won’t fail in your destiny either, but you’ll be greatly rewarded,
as you come under the shadow of the Almighty and cross to the other side.
You’ll be so thankful you heeded the message: *the wonderful cross as your guide.

P. A. Oltrogge

“On the same day, when evening had come, He said to them, ‘Let us cross over to the other side.’ Now when they had left the multitude, they took Him along in the boat as He was. And other little boats were also with Him. And a great windstorm arose, and the waves beat into the boat, so that it was already filling. But He was in the stern, asleep on a pillow. And they awoke Him and said to Him, ‘Teacher, do You not care that we are perishing?’

“Then He arose and rebuked the wind, and said to the sea, ‘Peace, be still!’ And the wind ceased and there was a great calm. But He said to them, ‘Why are you so fearful? How is it that you have no faith?’ And they feared exceedingly, and said to one another, ‘Who can this be, that even the wind and the sea obey Him!’”

Mark 4:35-41 (NKJV)

“Very truly I tell you, whoever hears My Word and believes Him who sent me has eternal life and will not be judged but has crossed over from death to life.”

John 5:24 (NIV)

“…that just as Christ was raised from the dead by the glory of the Father, even so we also should walk in newness of life.”

Romans 6:4 (NKJV)

The Porch of the Lord

No comments – you could add the first…

www.last.fm/user/daverave38/loved

More on WordPress.com

Featured

blueprint not required

believe it, He’s coming

We do not require a map or blueprint for our respective lives, we need Jesus

blueprint it is 8:38.33AM it was just now.

links to access, IF YOU WISH

nice one
post/1988
IF God had no Love for you you wouldn’t even have the chance bitching and moan about the life some obviously do not have respect of… OR for. don’t be a sad complaint-monkey; get up; go try again you think YOU have problems? it’s childish to think the world (testing ground deserved Angelic rank) revolves around you and me?
God forbid… let go of your life.
i dare you; people might think
it’s a drag: being dead, but do
consider that in that ‘existence’
is being dead to all those rotten
experiences. how do we think a
Monk or Nun ENJOY Life, being a
hermit or stolid prayer? well, let a
concept go rooted deep, way deep,
way way down, in complete… dig it.
think these ideas over. oust the demon-crats…
dig or not, it, like all your decisions, will be, are, were completely up to you. deal.
David Buckle‎ to

August 16, 2014 ·


Let me be the more recent reminder to solve some

a great mystery, to MOST of you on earth.

David Buckle has believed in God’s active

intending in my everyday life since 1973.

Prayer is everyone’s doorway, path, road,

where you, too, will see. IF that’s in your

cards. By that we mean all have destiny’s

for a sign-laden adventure we’ve named “LIFE”.

Faith: ALL ARE CALLED; few RSVP. dig; or not; that

choice is one of the most important events you should,

in my humble opinion, rethink your position about.

TODAY’S PERSON HAS THAT RIGHT TO JOIN GOD

IN THE BY AND BY. EVENTUALLY, ME INCLUDED, WILL PERISH.

D I E…

BE NO MORE

ON THE PHYSICAL.

This is our preconceived

alerting, to you, to everyone

and their dog.

David

INVITES YOU ALL TO THIS BLOG. YUP, THIS IS MY ADVICE TO ALL YOU KID’S.

www.last.fm/music/X%27s+for+Eyes/+wiki?ver=11

www.bobskaradio.com bbnradio.org/english/hear

NOW MORE THAN EVER

www.last.fm/music/Steel+Pulse/_/State+Of+Emergency CHANT A PSALM A DAY

www.last.fm/music/Liz+Phair/+images/40949533 CALIFORNIA

www.last.fm/music/Lisa+Stansfield ALL OF HER MUSIC

www.last.fm/music/They+Might+Be+Giants/+images/70282798

ALL OF THEIR MUSIC starting with their first self titled album [1988]

THESE MUSICAL INSPIRATIONS ARE

Bible Broadcasting Network (BBN) Broadcasting & Media Production Company

'www.bbnradio.org'

115,453 Likes 1,434 talking about this 221 Comment Now, ‘aint one to be political, but… allnewspipeline

you know, the specific point in time is, has been, important to me. to remember where was my place, in time at any provided date, is a fail-safe reminder to what was happening inside the meager effort required to facilitate the period and that will required to activate said effort for the futuristic consideration of those who do pay attention. that instruction: ‘PAY ATTENTION‘ had always been a constant rule in my houses of the freedom of youth David had been blessed enough to enjoy, for nineteen years starting: 1973. 1973, there was a year. Always, from then to 1976, Alabama (Oxford) was my observant period. yup dotted with incidents of wonders and satisfaction: “i am free; to do whatever seems as the way to go at anytime; to see whatever event presents itself, no matter the distance in front of my shoes on my feet: converse, low-tops, blue if i remember right.” JUST THEN the life that did lie before me, in front of the coolness filling a body from the cool cement against a tanned belly/stomach on that front porch. yea, Oxford. third grade. the elementary school attended was in the Afro-American section of that tiny town. why, some of a more honest, and respectful group of friends David ever had was the part of that student body; the one where friends were made, kept, treasured like Dee. my best

friend Dee had an older brother, Randy. Randy was the one who showed me the wax that he ‘n’ Dee used to keep their always groomed hairstyles of tight curls so evenly set to shape all the day long. it was then that made the choice of using that method of hair stuff David would use. the folks are from Trinidad, it was the type of music i grew to dig. reggae. “could you be love…” 964 abums for your ears

https://www.last.fm/music/They+Might+Be+Giants/_/Birdhouse+in+Your+Soul

Every place that the sole of your foot shall tread upon, that  have I given unto you.

Golden Years

I Said unto Moses.

Now to Him who is able to keep you from stumbling, and to make you stand in the presence of His glory blameless with great joy, to the only God our Savior, through Jesus Christ our Lord, be glory, majesty, dominion
Somewhere Over The Rainbow
Nina Hagen images.google 7

New Beginnings

Go Love Christ, or not; It’s all up to You.
go love Christ, or not; it's all up to you.
Promoted By
go love Christ

Chant a Psalm a Day

Elastica Elastica Elastica

Burning Down The House

success

xx
universal radio
The more we stare at the problem, the more rooted it becomes2:44 AM (7 hours ago)
Be Fearless Nunsexmonkrock i know who i am, and i am willing to i proclaim myself to the world
https://onlizinenet.blog/2020/06/12/the3rdonlive-wordpress-com-2/
God Calling July 14 – True Success
Our Truthful Future
Featured

STAY HOME

Drink deeply from this truth. God is able to keep
you from falling! Does He want you living in fear?
No! Just the opposite. “The Spirit we received does
not make us slaves again to fear; it makes us children
of God. With that Spirit we cry out, ‘Father.’ And the Spirit
Himself joins with our spirits to say we are God’s children.”

(Romans 8:15-16 KJB)

you’ll wish you had, in 14 days, when covid19 death, shows up.

Featured

He’s coming

God willing before U.S. government transforms. JESUS FOR PRESIDENT

get mellow with us, you may doubt; at your own peril.
is not so much a warning, but an announcement. be wary. is not tragic, it’s relief for some.
maybe you had not heard this… ‘re not required to, however listen: dig.

try it; you’ll be everything but losing. discipline is required.

All these inspire me to keep living, these are examples of love and triumph.

the3rdonlive.wordpress.com/2020/07/05/not-1-to-bother-with-this-but

Featured

peace

peace be still. it will be okay. bless you all.

https://wordpress.com/post/the3rdonlive.wordpress.com/3620 https://wordpress.com/read/blogs/156658687/posts/4236
https://www.pinterest.com/pin/818107088550234866

love video

https://wordpress.com/view/the3rdonlive.wordpress.com

google.com/search?q=the3rdonlive
Featured

the3rdonlive.wordpress.com

Paul Harvey

https://the3rdonlive.wordpress.com/may-5-2020-757-22
https://wordpress.com/view/the3rdonlive.wordpress.com
not a real doctor, but i’m a real worm that likes to play.
youtube/channel/UCbjNC5u2AwhDnty61fSHw/discussion

The Upper Room was occupied by 120 disciples.

Since there were about four million people in Palestine,

this means that fewer than one in 30,000 were Christians.

Yet look at the fruit of their work. Better said, now look the

fruit of God’s Spirit in them. We can only wonder what would

occur today if we, who still struggle, did what they did. “Wait on

the Lord in the right place.”

www.the3rdonlive.wordpress.com
these SITUATIONS COULD EXCHANGED EXACTLY SWITCHED WITH TODAY’S NEWS program
May 5, 2020
Dr. Worm
Featured

tried…

met David in 1997 in NCHEY DAVID, HEY CAROLINE!

did senda note to Angie Petty: The King James Version WATCH ME DANCE! Bhttps://www.youtube.com/watch?v=fff6LFVrsmg collactiona.live

Liz! Let meet!

love… love you!
‘m a man, and do,
so very much, hope
that not disqualify me. ;’)

listen up folks, this is seriou; sthese days
LOVE IS NOT A REQUEST; IT IS A COMMAND.

David’s YouTube setup, dig

https://www.youtube.com/watch?v=KtNhtJxzDWs

Rob Reiner digs Biden, Biden seems the

lesser most evil’s that were attempting;

the uNITED sTATES Of aMERICA, loved

nation that is, sitting on the edge, of that

precipice of God‘s wrath. Hope you are a

faithful cAT WHO HOPE’S TO AVOID THIS:

movie that inspired me to create band.

THIS IS A FUTURE IF WE DON’T STOP 5; man, call me a kook, but neh-neh, pray you are in Christ.

if nothing happens we’re fucked. there is no ‘rapture‘ on His book.

www.youtube.com/watch?v=4cia_v4vxfE&feature=youtu.be

www.biblegateway.com/audio/mclean/kjv/Isa.45.17

Harold?

walk by your spirit

David Jun 26, 2019 · cruise, @ least twince in life

don’t trip one another… phew that; too

weird. only lately began to mind the ‘.’ rule…

may be that it was the seemingly bogus rule

that states it is unwise to fool around with the

rule once taught by a teacher, we’re talking a

HIGH school teacher and elementary teacher.

as you are college-aged you (UNLESS YOU’RE

SOME SORT OF SAVANT it can only assume it

true, that you’re like me. now that’s sort of ever

standing notion. but it doesn’t work. are you in a

relationship with the Spirit? no? well, my talking

slower will show nothing that’s effective for any of

you, us, whatever. things will arrive to you in a slow

manner; but if what is had to share, needs a requisite

of spirit, you walk by the Spirit, admit dependency on

Him moment by moment. be filled with the spirit. He’s

in control. be sensitive to initial promptings of the spirit

be guided, able to be shown. the spirit of God will not be

leading you to any thing that is not in accordance of your

benefit. be sealed. the Holy Spirit seals you in Christ.

……………………………………………………………………………….

gosh……………………

lots to feel over; but that’s not my style. see, when you care in fashioning YOUR prose to FIT nicely into whichever group’s pocket you ARE CREATING A DISSERVICE TO YOURSELF AND TO THOSE WHO YOU CARE ABOUT. that being said here comes some free-writing, complete and as unexpurgated as most of the stuff that creep from this mind onto a computer screen.

maybe one in your frame of reference, may be not. seeing this bitter combat going on betwixt

cads handing some higher-ups, in the political scenes of America, handed their own asses. sad to see the dumb dem’s attempt to shy away from the asses they’ve made of themselves. The current exploiting of their own thin masking their true aim, Donald is a shoe-in; If only by the sheer ineptitude of the elephant’s.

Featured

THIS JAZZ

listen to Super jazz

https://the3rdonlive.wordpress.com/2019/09/18/mr-mellow

The David Maynard. says

word of Prayer

PRAY much for us;

that He is how He helps us,

we’re to be used; for the honor of our Lord (Jesus)

OUR dear Lord:

www.gettyimages.com//nina-hagen-rock-in-rio-circa-1985-in-rio

Nina Hagen shrine @ wordpress

www.gettyimages.com/photos/1980-1989-Nina Hagen-photos-family

Xanga


In Jesusname be; born of God.

When you get saved you sin? yup, repent.

the Bible says if we confess our sin it will vanish.

He is wiping away our sin:

our transgressions we battle against the flesh.

testify – testify? what?

WE should love one another

to from our first breath, our beginning, He loved us.

He never quits;

fear thou not.

for I Am with you all.

onlizinenet.blog

There’s respect that none really wants to earn; not this way.
Thank all veterans from the bottom of my heart and soul. too, few the population doesn’t even heed those who placed their life in the way of so much the tragedy they DO have absolutely no concept of; therefor they do not respect U.S. Marines, Seamen, Soldiers, Airmen, Coast Guard is there law that says all man who enjoy those freedom’s bought via some good United States Citizen laying down; in a deathly rest, to make certain all those born in a USA continue to have those right: go on to continue do things: refuse
to
support
Wounded Warrior,
go burn flags, cuss at Police,
to NOT honor Firemen, first responders:
ALL of Those Selfless Americans
who love A M E R I C A

THANK YOU

https://the3rdonlive.wordpress.com

https://the3rdonlive.wordpress.com/2020/04/07/look-away-2

Featured

EVIDENCE

channel/UCe79fT-Y5nYhADxuD

Description Nowsthetime.org : If you need answers you have come to the right place. The Choices we make today will determine where we spend Eternity. We live a lifetime of planning for this life but what about your plans for your Eternal Life? You will live for an Eternity either in Heaven or in Hell the choice is yours. This Channel serves as tool to share the Good News of Jesus Christ with the World. Join us as we reach out to this lost and dying World with the Good News

onlizinenet.blog

of our Lord and Savior Jesus Christ.

https://www.youtube.com/channel/UCVW-2rLA1wXXr32fmeF3bHg
onlizinenet.blog/400
0o
LOOK HERE…

Featured

took a break,
but then again;
it was not such a
successful jaunt, we
were n bad way where
the fact nobody has ever
sent me a message, barring
Patricia; her i enjoy seeing that
she read what i placed on original
website that is a little bit over a year
old. dunno, are you pals at WordPress
intercepting my e-mails?  ones has got to
wonder. if your sight is catching messages in
the helpful spam eliminator that is a welcome in
wonder. if your sight is catching messages before
i see them, okay, it makes me sad that some of your
‘happiness engineers’ seem to have me and my Christ
following marked, as what i have no idea. there is a lot of
situations in the future that we would like to be a benefit to US. i see that the 48 states are receiving WP,

where in HI’s
link?
just A Pinterest sight:

https://www.pinterest.com/DavidBuckle3/boards is a
cool thing… 

Featured

experiencing faith failure

eXperiencing the faITH FAILURE – the chief quality of those called having answered on August 17, 1862 Pastor Charles Spurgeon:

You’re about to overcome something, it, you had been dealing with, considering, perhaps battling with for an unmentioned long period of time.your heart and mind

will soon be peace again. patient, everything will be okay.

… The Holy Spirit Glorifying … Jesus Christ

Lalania Riley Hall RIP

The Holy Spirit Glorifying Christ

SOME MAY REBUKE THE NATURAL URGE TO BE ASSISTED, i know the choice to let go, let another in on understand what,

it’s 7:00AM; we consider our own secret that we wouldn’t be

comfortable flashing in public. what would any one think?

.Does our Bible say we can pray private, and be heard?.

In the King James Version of the Bible the text reads and when we pray we should not be hypocritical; see:they love to pray standing in the synagogues and in the corners of the streets, that they may be seen.

Matthew 6:5 
......................................................................................................

Unauthorized?

this‘ server will not verify that you, or your mind. we are authorized to access the document requested; but you’re not. Either you typed the wrong credentials (bad password,) or your computer’s brain does not understand how to utilize our service. well, fine then… we think Alex would be upset with you guys. so there.

it isn’t our opinion that any Bible be charged for, censored,

or charged for, it is His letter to us, written by His servants; for US; any who charge fees might be chastised, yet that is not what He‘s about; so take heart.

it is 8:02AM

Featured

“God Has No Rival!”

  1. posted on Daily Encouragement:
  2. https://youtu.be/K0uyh2IH72w
  3. God Has No Rival!”
  4. A view looking up Kraybill Church Road from our driveway.   “God Has No Rival!”
  5. www.youtube.com/watch?v=0kpJp2W6i9Y

https://www.pinterest.com/davejbuc3

sovereigngracemusic.bandcamp.com/album/together-for-the-gospel-live-ii

  1. Stephen C. Weber“Changes, Challenges And Choices”
  2. Message summary: Today we will consider changes, challenges and choices. Listen to this message on your audio player.
  3. “Choose for yourselves this day whom you will serve, whether the gods your ancestors served beyond the Euphrates, or the gods of the Amorites, in whose land you are Which of course elicits a number of responses. Bunny then says,
  4. “Today is the day God has given me the opportunity to tell you that Jesus loves you!”Yesterday he went along with us for our chaplain visits, especially looking for opportunities to minister to truck drivers. Our first company yesterday receives many containers from a port and Bunny is seeking ways to share God’s love with these drivers.At this company we have the opportunity to share a brief devotional message early each Tuesday morning so yesterday I asked Bunny to share. He shared that we all have changes, challenges and choices in life which prompted today’s study.Some 3,400 years ago Joshua gave his final challenge to the children of Israel. He had lived his life in steadfast commitment to God. He’s first mentioned in Scripture as the trusted commander of Moses’ army shortly after they crossed the Red Sea during the Exodus. He, along with Caleb, was one of only two spies to bring back a faith-filled report that essentially said, “With God’s help we can do it!”Joshua had faithfully served under Moses during the 40-year period in the wilderness and had led God’s people in the conquest for some 25 years. He’s now 110 years old and musters enough strength for a final challenge to faith and commitment that rings through the ages.The people were experiencing three C’s that people all though the ages have dealt with. 
  5. 1) Changes – The Israelites had entered the promised land under Joshua’s leadership but now were about to experience a change. Things weren’t going to stay the same; there would soon be new leadership. We go through many changes throughout the course of our lives; some major, even life-transforming, others smaller. Most of us really don’t know what change we will encounter today, but great assurance can fill our hearts when we remember that God said “I the Lord do not change” (Malachi 3:6). He is a steady presence in our life, the anchor for our faith when all other ground is sinking sand. Thomas Chisolm reminds us that we can rely on our unchanging God in the hymn classic, Great Is Thy Faithfulness: “Thou changest not, Thy compassions, they fail not. As Thou hast been Thou forever wilt be.” 
  6. 2) Challenges – Changes often bring on challenges. Although the people had entered the promised land many challenges lay ahead for them. Just keep reading and you’ll see one challenge after the other! In our lives changes usually bring challenges as well and just like the Israelites we will receive blessing when we obey God.
  7. Choices – Usually there are choices we must make as a result of changes and challenges, and that makes life hard. Today we will all make many, many choices. Life is just full of choices and decision-making, from tiny daily choices such as what brand of soap to purchase or what to eat for dinner to major, life altering decisions such as our choice for a mate or career. Many choices do not have moral consequences but many others are a choice between right and wrong. “There is a way that seems right to a man, but in the end it leads to death” (Proverbs 14:12). However there is one fundamental choice we all share, based upon today’s portion of Scripture in the Old Testament. Joshua set the fundamental choice clearly before the people with these words, “Choose for yourselves this day whom you will serve”. In the context of Joshua’s challenge their fundamental choice was between serving the one true God and “the gods your ancestors served beyond the Euphrates, or the gods of the Amorites, in whose land you are living.”In a broader sense the choice now and for every generation is whether we serve the one true God or “the god of this world” (2 Corinthians 4:4). Even those who practice the faith of atheism are essentially serving the god of this world. People then and now have this fundamental choice, for the one true God does not force people to love and serve Him.Joshua sets a great example for the people of his time and through all subsequent ages, including our own. Let us proclaim this day, “As for me and my house, we will serve the Lord!”
  8. Be encouraged today,
  9. Daily prayer:  Father, You have drawn us with an everlasting love; You show us Your loving kindness day after day. Your bountiful provision gives to us material, physical and spiritual blessings that only a caring heavenly Father can give. But even though our cup overflows with Your goodness we face changes and challenges amidst our blessing. As we deal with the inevitable changes and the subsequent challenges that follow help us to make the life defining choice, like Joshua, and declare to all who will hear,
  10. “As for me and my house we will serve the Lord.” 
Featured

hey USA

https://www.youtube.com/watch?v=_HEkAmRwtZ0

https://www.youtube.com/watch?v=H2o89oapdFY

https://www.youtube.com/watch?v=qQAgiP8zQ6M

https://www.youtube.com/watch?v=mK71M6C_RUg

https://www.biblegateway.com/passage/?search=Romans%208:28&version=KJV

https://the3rdonlive.wordpress.com/2019/10/27/hey-usa-https-wordpress-com-block-editor-post-the3rdonlive-wordpress-com-1989/

Featured

invitation’s not only said

dig it

To those who know Me not, there is in Me nothing to appeal to them, or to attract them.

Those who know Me there is nothing more to be desired.

“No beauty they could desire Him.”

Oh! My children, draw very near to Me. See Me as I really am,

that ever you may have the Joy of finding in Me all you could desire.

The fulfillment of all you could desire in Master, Lord, or Friend.

such is the this case here, my friend,
‘m not upset…

All Are called… few RSVP, huh?

Featured

https://youtu.be/b3PwozgRtHQ

USMC

truth will conquerhttps://the3rdonlive.wordpress.com

i am not afraid to trust in The Holy Spirit. regardless of the recent statements of “i”, and it seeming vain and self-serving, let me assure you: Such is in no way factual, i work for Him.

https://www.pinterest.com/davejbuc3/american-heroes
a sort of enthused effort to garner past viewers to come back.
updated; as are most of the pages Lee puts up
and that being said all are encouraged to visit our sight on all remembered revisiting – there will be no ‘newer’ posts as of a few days ago. we had attempted to gain followers as nest as a wholesome ingredient provider can/could. all lurid posts, the mass of web-traffic seem to go the easy r0ute: seks, dogas & free stuff… “THERE ‘AIN’T NOTHING FREE, AND TOO DAMN LITTLE FOR A BUCK ANYMORE.” – well, there ya have it: the world is all consumed with the god of the air. it’s plan is for to do as you will, forgetting deserved ramifications. to those it is responded with displeasure coupled with pleasure; see… a sinful character are always welcome in Jesus’ corner, just as you are; no past behavior will be remembered, providing a sinners regret/faith is genuine. all are welcome. there is not a ticket, or ANY ‘price’ required. come as you are; He will not be fooled. GO AHEAD TRY. do enjoy His bigmercy to all.
.-.-.-.-. https://wordpress.com/block-editor/post/collactiona.live/2068 .-.-.-.-.
Mark Armstrong, The Wo
Featured

FEAR NOT

October 3 — Blessed Assurance
And the work of righteousness shall be peace; and the effect of righteousness quietness and assurance for ever. 
      — Isaiah 32:17.
Be still and know that I am God. Only when a soul attains this calm can there be true work done, and mind and soul and body be strong to conquer and to bear.
The Peace is the work of righteousness — living the right life, living with Me. Quietness and assurance follow.
Assurance is the calm born of a deep certainty in Me, in My Promise, in My Power to save and keep. Gain this calm, and at all costs keep this calm. Rest in Me. Live in Me. Calm, quiet, assured — at Peace.
Elect according to the foreknowledge of God the Father,
through sanctification of the Spirit, … Grace unto
you, an
Featured

September 29: Touching my Arm And sought Him that they might only touch the hem of His garment; and as many as touched were made perfectly whole. Matthew 14:36 Thy touch has still its ancient Power Yes! when you are quiet before Me I lay My Hand upon each head, and Divine Spirit flows through that healing, powerful Touch into your very beings. Wait in silence before Me to feel that. When you look to Me for guidance My Hand is laid upon your arm, a gentle Touch to point the way. When in mental, physical, or spiritual weakness you cry to Me for healing, My Touch brings Strength and Healing, the renewal of your youth, the power to climb and strive. When you faint by the way, and stumbling footsteps show human strength is waning, My Touch of the Strong and Helping Hand supports you on your Way. Yes! My Children, My touch has still it’s ancient Power, that Power is promised to you. So go forward into the future bravely and unafraid.

They that wait upon the Lord shall renew their strength.

To discover the Pearl of Great Price is to renew your youth.

The Kingdom of Heaven is a kingdom of perennial youth.

AWAITING, PATIENTLY FOR WHAT’S COMING OUR WAY

hear this

David Buckle

David Buckle
323.3k
monthly viewers
the3rdonlive.wordpress.com

7,883 Pins nifty..

sadness… See; the above cartoon depicts me look,ing at the3 world inside the cartooning i did at one time… it was 1986 i think, dudn’t matt3er… anyhow – i have a great friend, Eric, who heard David an-nounce whilst leaning Dad’s ping-pong table, Eric was first/second chair french horn, along with Joe… they were both phenomenal musicians, and like me and Laura, swapped 1st and 2nd chairs our senior year at Brazoswood High;

anyhow Joe went on to Baylor, i think, Eric to University of Houston, only after traveling to Europe attending the Brahms School of Music. Eric was that good, SO Eric met, in that music school, France? Germany? Vienna?

well, yo no se’… ANYWAYS he met Guinnivere who was from Charlotte, and he was a nursing assistant at the same Carolina’s Medical Center that was my rehab. too weird, huh? So, that summer, got the first, of four apts,

Thanksgiving of 1993 found me having supper with Guinnivere‘s folks, A wild coincidence, huh? Spoke to him i that year, and he’s in some farm-land in Oregon, or somewhere, built him a cabin, they had two kids, cool.

“man, Charlotte NC‘s where ‘m headed, soon as get through with college” well… i did gOt through with college the first few day’s of October, 1992…

sooo… all’s going according to coincide with my 1988 prayer life… nifty

[…]

[…]

Parents of special-needs students noticed problems immediately. Amy Jackson, a night-shift nurse in Wellington, has a daughter, Megan, 12, who has epilepsy and whose neurologist recommended she limit screen time to 30 minutes a day to reduce seizures. Since the school started using Summit, Megan has had seizures multiple times a day.

[…]

Some parents said they worried about their children’s data privacy.

Photo Gallery

Websites

He brings Strength and Healing, the renewal of your youth, the power to climb and strive. When you faint by the way, and stumbling footsteps show human strength is waning, My Touch of the Strong and Helping Hand supports you on your Way. Yes! My Children, My touch has still it’s ancient Power, that Power is promised to you. So go forward into the future bravely and unafraid. is now live. well, we should hope so 8.)

Now unto Him who is able to keep you from falling, and to make you stand in the presence of His Glory blameless with great joy, to the only God our Savior, through Jesus Christ our Lord, be glory, majesty, dominion and authority, before all time and now and forever. Amen.
Jude 1:24-25
4:44 PM (3hours ago)

1976 dave danced all the way to Man-o-War blvd.
Todd produced The Beatles
https://photos.app.goo.gl/bL55x9wHQRqVJLQY6
Todd Rundgren
to Jose, Tim, BE NOT AFRAID! https://youtu.be/bS7Ityj6KmM dig…

Joy!  WCOK the gospel of these mountains – 
https://photos.app.goo.gl/bL55x9wHQRqVJLQY6

David Buckle

https://www.youtube.com/watch?v=vM9-e3tFN6I&feature=youtu.beOU

OUR testimony
We wouldn’t lie to YOU
Featured

He works, trust .

https://youtu.be/bsDv5OHbirg
coming from The spiritually reliable source.
hear AND LEArn
https://www.pinterest.com/davejbuc3
My Mercies are great to all who turn to Me and to all who turn from me.
How tenderly I yearn over these wayward ones.

How I seek ever to save them from the hurts their very refusal
of Me will bring upon them. I long to save them from the hunger
of loneliness that will follow their driving away the only love that
will satisfy.

www.pinterest.com/davejbuc3/truth-as-we-age-it-becomes-clearer
it’s 12:00PM, smile, you made it this far,
don’t quit, it will make you sorry, believe you
me. take it from one who has been there before.

oh, and by the way, what it’s for AND about is Him, God.

https://wordpress.com/view/the3rdonlive.wordpress.com https://www.youtube.com/watch?v=yqw9zlK-un0https://wordpress.com/view/the3rdonlive.wordpress.com https://www.youtube.com/watch?v=oHfNY3Ufl88 https://www.youtube.com/watch?v=aI7fe5FsgJg

ONCE AND FOR ALL, I AM NOT GOING TO TOLERATE BEING PINNED AS non hetero.

thank you. May God have mercy on your souls.

The moment we recognize our complete weakness and our complete dependence on Him will be the very moment that the Spirit of God will exhibit His power.

– Oswald Chambers –

https://www.youtube.com/watch?v=x6csBPYfOH8 https://the3rdonlive.wordpress.com/2019/08/23/if-you-only-believe-anything-is-possible-for-those-who-believe 

I am among you as one that serveth.

Yes! remember to serve all.  Be ready

to prove your Son-ship by service.  Look

on all you meet as guests in your Father’s

House, to be treated with Love, all consideration, with gentleness.

As a servant of all think no work beneath you.  Be ever ready to do

all you can for others.  Serve. Serve. Serve. There is a gladness in

service, a Joy in doing My Will for others, in being My expression

of all good for them.

Remember that, when you serve others, you are acting for your

Master and Lord who washed His disciples’ feet.  So, in service

for others, express your Love for Me.

View more posts

P

Daily Lesson
The question is not what you will do to get what you want or where you want to be.  The question is what are you willing to give up?  Nothing in this world is free, everything cost, money, time, or love.  The three most important things in our lives.  What are you willing to give up for this world, for the spiritual?

If the message in the Daily Life Lesson is not clear, 
please feel free to ask for clarification or if youwish to submit a Daily Lesson please contact mehisgentletouch@gmail.com

https://wordpress.com/read/blogs/164027947/posts/1472
…. https://the3rdonlive.wordpress.com/2019/09/18/801 ….

Daily Lesson


The question is not what you will do to 
get what you want or where you want to 
be.  The question is what are you willing 
to give up?  Nothing in this world is free, 
everything cost, money, time, or love.  
The three most important things in our lives.  
What are you willing to give up for this world, 
for the spiritual?



If the message in the Daily Life Lesson is not clear, 

feel free to ask for clarification and IF you
wish to submit a Daily Lesson please contact me
hisgentletouch@gmail.com

http://www.the3rdonlive.wordpress.com/2019/09/26/he-works-best
Featured

wordpress.com/read/feeds/78716935

During our times of becoming or being emotionally and mentally tired, we often focus on how to revenge ourselves from those who come after us with evil intentions. This is not the proper way in how we should handle what looks like to many of our defeat. We should never ask our FATHER in the name of JESUS to bring about harm or to quote back to HIM this scripture, [vengeance is MINE, said the LORD].

Before the crucifixion of JESUS CHRIST, those prayers that we find in the Old Testament would have been sufficient. But after the crucifixion of JESUS CHRIST, they no longer are. During the time when JESUS CHRIST walked among HIS creations, mankind. JESUS spoke and taught about being loving even to those who will come against us.

Nehemiah 4:4 Our FATHER can see clearly that the loads that we are carrying because we have not taken them to HIM, has caused us to become mentally and physically weaken, that our strength is about to fail.

Our FATHER has mercy for us, we have HIS loving-kindness, we have HIS pity. HE is not blind, HE does not turn HIS head to keep from looking at us. HE is aware that some of us are filled up with the contempt and pride of others. They ridicule us because they are arrogant and prideful. The problem is that some of us are not aware of these facts. And because of our ignorance of these facts, we do not live our lives knowing that our FATHER provides us with HIS grace because we are afflicted and humble.

https://youtu.be/tDwcSOUKRkA

https://youtu.be/jlFXhigvTvM

https://www.youtube.com/watch?v=AZQxH_8raCI

Featured

There is no fear in love, Perfect love casts out fear. because fear hath torment. it is he that fears that’s made perfect in love. …………………………………………… 1 John 4:18

LET US GET IT FINISHED; AS JESUS CHRIST/GOD FINISHED IT; YET THIS BIGGEST TRUTH; IS ABOUT AN INFERENCE TO WHO, NOT WHAT, IS THE RULER OF MY HEART, THE WORLD TO COME: HEAVEN, THE ETERNAL GIFT. A HOME FOR ALL WHO DILIGENTLY SEEK HIM, NOT him

El

Elohim

_ Elohim (Hebrew: אֱלֹהִים [ʔɛloːˈHim’]) is The Word, The Word was God, and The Word is God. _

Jose San Martin Tue, Sep 24, 9:00 PM (3 hours ago)
https://wordpress.com/block-editor/post/the3rdonlive.wordpress.com/1441
https://en.gravatar.com/davidb48

Daily Lesson


A house is made of bricks and wood.  

A home is made of love.  Let love be in

every room and in the hearts of all that

live there.  Let it spread to everyone you

meet one by one and perhaps one day we

will have the world that the Lord intended.

Lord, watch over those I love, remind them 

they do not walk alone and guide them with

Your gentle touch. All things work together for good, for them that love the Lord. even the tragic event whereupon this sinner was spared from the end deserved. thank God.

If the message in the Daily Life Lesson is not clear, 
please feel free to ask for clarification or if you wish to submit a Daily Lesson please contact me: hisgentletouch@gmail.comt

https://the3rdonlive.wordpress.com/2019/09/25/1441
iT’S WHAT COULD BE DONE, SO THIS IS. I AM FOR
HIM WORKING ,TO ASSIST THE ONLY POWER THAT
KEPT ME ALIVE; AS TO REACH THIS POINT IN LIFE.

i am not afraid to trust in The Holy Spirit. regardless of the recent statements of “i”, and it seeming vain and self-serving, let me assure you: Such is in no way factual, i work for Him.

https://www.pinterest.com/davejbuc3/american-heroes

a sort of enthused effort to garner past viewers to come back.

updated; as are most of the pages Lee puts up

and that being said all are encouraged to visit our sight on all remembered revisiting – there will be no ‘newer’ posts as of a few days ago. we had attempted to gain followers as nest as a wholesome ingredient provider can/could. all lurid posts, the mass of web-traffic seem to go the easy r0ute: seks, dogas & free stuff… “THERE ‘AIN’T NOTHING FREE, AND TOO DAMN LITTLE FOR A BUCK ANYMORE.” – well, there ya have it: the world is all consumed with the god of the air. it’s plan is for to do as you will, forgetting deserved ramifications. to those it is responded with displeasure coupled with pleasure; see… a sinful character are always welcome in Jesus’ corner, just as you are; no past behavior will be remembered, providing a sinners regret/faith is genuine. all are welcome. there is not a ticket, or ANY ‘price’ required. come as you are; He will not be fooled. GO AHEAD TRY. do enjoy His bigmercy to all.

.-.-.-.-. https://wordpress.com/block-editor/post/collactiona.live/2068 .-.-.-.-.

Mark Armstrong, The WordPress.com Blog
Mar 25, 2019

Electric Literature Moves to WordPress — Here’s How an Indie Publisher Thrives on the Open Web
Electric Literature launched 10 years ago in Brooklyn, New York, as a quarterly print journal with a mission to make literature more relevant, exciting, and inclusive. And today they’re celebrating the launch of a new website on WordPress, at electricliterature.com.

Surviving (and thriving) for ten years as an independent publisher is no small feat. Over the years the nonprofit organization has grown its online audience — with offerings like Recommended Reading and The Commuter — while expanding its membership of readers who help fund its work. The website is free to everyone and relies on the generosity of its community to donate to the site and support its mission.

How does an indie website make its business work in 2019? We talked with Electric Lit’s Executive Director Halimah Marcus about some of the lessons they’ve learned in the past 10 years.

Slow and Steady Growth Can Be a Very Good Thing Focus On Your Mission.

chineloanikpeogechukwugmailcom

Ihagh G. T.
Mar 25, 2019
👍👍👍… inspiring post, especially the longevity,10 years, which includes some other ingredients…I can see a lesson for passionate site owners: their peers ending business, especially when the initial dream was to stay in business without ever leaving. What might have halted them? Well, that would be a story for another day.

Certainly, longevity will bring about many many subscribers/membership. passionate people already have passion, so the watchwords I can perceive from your post are: “persistence, positivity and patience,” we will get there.


overbee
Mar 26, 2019
Your mission is a very important one! Keep up the great work and thank you for the inspiration.


Sarahmente
Mar 26, 2019
It’s fantastic to read that Electric Literature has been so successful while remaining true to its mission. A real inspiration to us all.

15Likes
Comments closed.

Child Of God, From The Darkness Into The Light
Dec 15, 2018

SOME OF THE POSTS DO NOT REFLECT ALL I BELIEVE IN BUT IN MOST PART THEY REFLECT MY VIEWS. MY TEACHER HIS THE HOLY SPIRIT. excellent, the best lessons are yet to come


Jonathan Caswell
Dec 18, 2018
obedience is better than sacrifice saith the Lord – HOW SO!

www.pinterest.com/davejbuc3/be-secure-in-life-know-there-is-more-than-meets-th/


Barry – Innerman
Feb 22, 2019
you are indeed a vey wonderful, and powerful woman the Lord is your strength Child Of God

Barry – Innerman
Feb 22, 2019
Thank you, God IS good
David Buckle


Cheri Lucas Rowlands, Discover
Jan 15, 2019

What Would You Do If You Could Do Anything?
What would you do if you could do anything? Tell us in the comments or in a new post.
siusanwbrownCJTCHBHeather’s Blog Spacetanishq Guptachristopherhull8442Esculenta officinalissimplyvaishvhandemaala
Load previous comments from vhandemaala and others

r3alizationz
Jan 22, 2019
If I could do anything, I would start a group of orphanages, schools, and shelters for children. All over the world.


Lexygirl Lessons: Requited Therapy
Jan 22, 2019
I would do therapy sessions in a different approach rather than the traditional red tape one. Maybe have a session with client while watching across the beach or a coffee shop rather than dreary clinic

12Likes
kennynines
kennynines
Jan 22, 2019
I would write a song, one that would fill hearts with joy and inspire people to share that joy with everyone. I would play it in coffee shops and bars for coffee and beer. I would release it directly into the public domain so anyone could play it anywhere, and the only thing I would really want from it would be to be remembered after I am gone.

Read More15Likes
Comments closed.

gthielges, gwenthielges.com
Nov 24, 2018

Just Like Joshua
Parents often repeat commands to their children for emphasis. In the first chapter of Joshua, he was told by God to “Be strong and courageous,” three times. God’s words in these verses seem to be a very matter-of-fact way of informing a willing man that the next steps must be taken, and success would not be a part of the equation if strength and courage were absent. The next steps were to obtain the land promised to the Israelites.

God’s marching orders held no promise that a supernatural feeling of courage would well up inside of Joshua’s soul. Nope. No “peace that passes understanding” feeling would signify it was time for Joshua to move. The words feel or feelings do not make an appearance in this chapter. God did not tell Joshua to feel strong and courageous. God told Joshua to be strong and courageous.

Did God promise His presence? Absolutely! But there was no promise that Joshua would not necessarily be shaking in his sandals as he carried out these sacred steps.

TerigthielgesDonna MillerSheri Traxlersusanslandry
Load previous comments from susanslandry and others
Healthy Living Mom
Healthy Living Mom
Nov 28, 2018
Thank you, Gwen, for this encouragement from Joshua. I’ve been camping out in this book for a couple of months and your words are timely. Especially, ” Courage is the strength to keep repeating to ourselves until we believe it that, “God is with me.” Thank you so much!


Healthy Living Mom
Nov 28, 2018
Thank you,

I appreciate your encouraging words! God is surely with us at all times!


Dec 6, 2018
When we rely on God’s courage and confidence,

we can accomplish anything

susan home schooling
Dec 20, 2018
So very true! Thanks for your comment!


path of life devotions, The Path of Life Daily Devotions
Jul 26, 2019

July 26, “Good”

In life there is doing “good” and being good; these things are not always found together.

A songwriter can write a good song without being a good person. A good person may be totally unable to write a good song. Go figure. Good works and goodness are not always companions.

“What Must I Do?”


Tradition calls him, “The Rich Young Ruler.” He had it all (to his way of thinking) but somewhere inside there was a void possessions and position and power did not fill. So He came to Jesus with this question:

“Good Teacher, what shall I do to inherit eternal life?”

Riverside Peace
Riverside Peace
Jul 26, 2018
Great message.
Love the song “God is so good”
Thanks for sharing


path of life devotions
Riverside Peace
Jul 26, 2018
Amen. Such a simple song with such a profound truth, Thanks for reading!
Steve


Riverside Peace
path of life devotions
Jul 26, 2018
Your welcome. I make it a habit not to ‘like’ unless I do read. If I love it, I will comment too. Have a great day.

ReplyLike
pathoflifedevotions
pathoflifedevotions
Jul 26, 2018
Means so much!
Steve

ReplyLike
David Buckle

Enter your comment here…
SEND
glastonburyeagle, We Write to Be Human
Jun 11, 2012


David
Jun 7, 2019

edharris8
edharris8
Oct 15, 2015
Might need to update your Bio…;-)

Right Now Counts Forever
the presence of Christ.

https://www.pinterest.com/davejbuc3/7132019-132pm

COLLACTION
Jun 24, 2019

must be,
and how exciting!

\o/

David Buckle’s, COLLACTION
Jul 6, 2019

Life’s storms

Featured

be ready to go

https://guns-are-my-friend.tumblr.com/image/17038158400

https://the3rdonlive.wordpress.com/2019/09/22/thank-you-happiness-engineer-2

sweet barbershop? caN YOU DIG THIS? – https://youtu.be/oL1JyDTq3Qc

www.pinterest.com/davejbuc3/boards

wanna mug? https://wordpress.com/read/blogs/152707401/posts/374

see, this WHOLE EPISODE WAS THE INTENDED,recall how we figured,

Jose San Martin Wed, Sep 25, 9:00 PM (12 hours ago)

you of all, took me seriously; asked how and the answer was rough?
Thank You!

https://the3rdonlive.wordpress.com/2019/09/25/there-is-no-fear-in-love-perfect-love-casts-out-fear-because-fear-hath-torment-it-is-he-that-fears-thats-made-perfect-in-love-2https://the3rdonlive.wordpress.com/2019/09/27/he-works-trust-2


Daily Lesson


The light has faded into darkness.  

I have lost my way.  My tears are like 

the falling rain.  I have lost my way. 

 all know someone who has, yet we

ignore them and do not reach out. 

A smile, a kind word, or a helping

hand might save not only a life but a soul.

www.today.com/home/5-things-know-about-caring-your-american-flag-how-retire-t131692

https://youtu.be/HVzpDl7Ale8 this goes out to you, Kim. https://youtu.be/uS90B4sZf7U

like i said: Katie’s brother kinda figured, but he was a senior; not fish friends. recall?

https://youtu.be/1vrEljMfXYo

https://www.youtube.com/watch?v=bS7Ityj6KmM

https://youtu.be/bsDv5OHbirg

https://www.youtube.com/watch?v=bsDv5OHbirg

Featured

Psalm 104

that’s it, you need to go through the valley, just don’t stay in it.

http://www.the3rdonlive.wordpress.com
i‘swhat i can do, so i do. don’t worry
about a thing it’s going to be okay…

www.pinterest.com/davejbuc3/american-heroes

social media does younger kids no good, ifn’ they do not have the wisdom to peer at images and not be affected, and do not avoid such stuff. our lives are so perfidious and this country’s morals are seriously out of wack, so agreeable to eyes that are continually seeking information. interest are a good attribute for kids and teens. this world we all live in is a wondrous; yet the advertising is… well, you figure it out. once an picture gets more than a glance it is in their malleable minds.

you know when stuff goes bad and falls all apart? you do not understand why this happened not that; like: you really want something for your birthday, or whatever, dudn’t matter… anyway, feel like you’d do anything to get that Christmas gift? and don’t find it under the tree that morning? you know what you call that? we call that life; get used to it. down here we suffer, we can look above; and aim in that direction; for that is where some will be; like forever, singing all the day long thanking Him for including us regular souls that at times are acting in a sinful nature. God knew that we will have those notions to act outside the will of God, yet that is the whole reason for His cross, Jesus Christ goes in our place to suffer the punishment we all deserve.

it’ll fill our minds, in the valley… get that SPRING of the valley.

https://youtu.be/kdWv3dATPSc
https://wordpress.com/block-editor/post/the3rdonlive.wordpress.com/1095

107 GBI RADIO.ORG, DOBSON, NC

https://i.pinimg.com/originals/f5/a2/65/f5a26585cf9d8ae39ac4347432d4be0c.jpg
have you reached the turning point?
it’s coming…
take that turn, my friend.
took disaster to have me on the good foot.

https://www.pinterest.com/davejbuc3

https://youtu.be/hwZNL7QVJjE

https://www.pinterest.com/davejbuc3/httpswordpresscomblock-editorpostcollactionalive15/
Featured

know

i remember when; He saved my soul. Jesus‘s nothing greater, how He gave me peace within… no matter how you face it; i remember when…

Love Leads

to this? yup

i came for water, but He gave me life.
collactiona.live
https://www.pinterest.com/pin/610589661962811505
https://www.intouch.org/listen/featured/my-assurance-god-is-in-control-part-1-radio

We are His… what other was is there?

Love and care and pray;
never feel helpless to aid
those you love. I am their
help. As you obey Me and
follow My Teaching in your
daily life, you will bring that
help into operation.

So, if you desire to be used to save another, turn to your own life.
As far as you can, make it all that it should be. Let your influence
for Me extend ever further and further. Let Love be your balm for
all ills, Power in which you will break down all barriers. It stands,
too, for the Name of the God you love and serve. with His banner
floating over you, go on in glad confidence to victory. Your task: to
help, to strengthen, raise, heal. Only as you love will you do this.  https://www.youtube.com/watch?v=Fnai9-4Fvcs

8-8-2019 11:10.348

Featured

July 5, 2020 AD 4:00

www.youtube.com/watch?v=KBvUmL-YagI&list=WL&index=4

Bravery at rest.
davidb49.blog

Front lawn to St. Peters 1999-2017AD

PUT YOUR HAND INSIDE THE PUPPET HEAD
JOY

remember that radio was gonna be tried?

love

https://wordpress.com/read/feeds/99330150

Maynard Ferguson

https://the3rdonlive.wordpress.com/author/davidb48

https://www.youtube.com/watch?v=zHd3vzyM1fw

https://collactiona.live

https://wordpress.com/view/the3rdonlive.wordpress.com
www.youtube.com/watch?v=XOvVOn_-XZs&list=WL&index=4&t=0s
the3rdonlive.wordpress.com
Featured

https://www.pinterest.com/pin/610589661969200616

nice
look at this, do not be angry.
Heal me, O Lord, and I shall be healed; save me,
and I shall be saved: for thou art my praise.
Jeremiah 17:14
 

Lord, come to us and heal us.
I am your Healer, your Joy, your
Lord. You bid Me, your Lord, come.

Did you not know that I am here.
With noiseless footfall I draw near
to you. Your hour of need: that of My Coming

Could you know My Love,
could you measure My Longing
to help, you would know that I need
no agonized pleading. Your need is My Call.

https://www.pinterest.com/davejbuc3/be-secure-in-life-know-there-is-more-than-meets-th/

COLLACTION

Come to Me, talk to Me, dwell with Me, then all will
know MyWay; a sure way, MyPaths are safe paths.
Pastor Arnold Murray

Come very near to Me.
Shepards Chape l

God Calling – Stray Sheep

__Two Listeners__ 2:29 AM (north Poplar?)
the3rdonlive.wordpress.com

___ God Calling ___   

August 10 – Stray Sheep
And he went a little farther, and fell on his face, and prayed, saying O my Father,
if it be possible, let this cup pass from me; nevertheless not as I will, but thou wilt.
Matthew 26:39
Oh Jesus, guide our footsteps lest we stray. For straying, My children,
there is no cure except to keep so close to Me that nothing, no interest, no temptation,
no other — can come between us. Sure of that you can but stay at MySide, knowing that,

View original post 277 more words

Jesus Christ be glorified

Him

He unfolds His own flag. He flexes his own muscles. Heaven does not ask

“How can I make David happy?” Heaven asks,

“How can I use David to reveal my excellencies?”

He may use blessings. Then again, He may use

Buffetings. Both belong to Him who saved me.

frogboy – be aware and stay tuned.

David Letterman Interview

dig this, we do

Nina Hagen Shrine

Circa 1985
Typed by Geoffrey Faustman @ Planet Bearth

*DL: ……This is her latest album right here [Holds up copy of “Ekstasy”] Nina Hagen in Ekstasy, Nina Hagen…

[Nina enters from stage left]

NH: Hi!

DL: Have a seat. Good Lord! [referring to audience’s frenzy over Nina’s appearance.] Now, I said you had pink hair and you had pink hair on the album. Obviously you are not wearing pink hair tonight. [Nina’s hair is long and black, pulled back in an “I Dream of Jeannie” style ponytail.]

NH: No, I just came from Greece and from Spain and I wanted to uh, wanted to look more Greek and more Spanish because we just shot a video down there for “Spirit in the Sky”, the old-hippie Norman Greenbaum hit from the sixties.

DL: Yeah, uh huh, so you changed your hair for that purpose?

NH: Uh huh, I always change…[cut off…

View original post 823 more words