our lives are but vapor, best smell the one we have at this time and place.
To those who know Me not, there is in Me nothing to appeal to them, or to attract them.
Those who know Me there is nothing more to be desired.
“No beauty they could desire Him.”
Oh! My children, draw very near to Me. See Me as I really am,
that ever you may have the Joy of finding in Me all you could desire.
The fulfillment of all you could desire in Master, Lord, or Friend.
such is the this case here, my friend, ‘m not upset…
All Are called… few RSVP, huh?
sadness…
For many years, Silicon Valley parents (aka tech inventors) have been sending their kids to private low-tech schools and limiting their use of tech, whereas other American families are being told that providing “high tech” educations is what’s best for their kids. An increasing number of experts and studies continue to warn that this is definitely NOT best for kids (see 1, 2, 3), and it’s not just about eye damage (see 1, 2) from excessive screen use.
When students at a private school in Australia were given a choice between a high-tech education or no-tech education, they chose no-tech. When American families aren’t given a choice, some are removing their kids from schools. From The New York Times:
The seed of rebellion was planted in classrooms. It grew in kitchens and living rooms, in conversations between students and their parents.
It culminated when Collin Winter, 14, an eighth grader in McPherson, Kan., joined a classroom walkout in January. In the nearby town of Wellington, high schoolers staged a sit-in. Their parents organized in living rooms, at churches and in the back of machine repair shops. They showed up en masse to school board meetings. In neighborhoods with no political yard signs, homemade signs with dark red slash marks suddenly popped up.
Silicon Valley had come to small-town Kansas schools — and it was not going well.
“I want to just take my Chromebook back and tell them I’m not doing it anymore,” said Kallee Forslund, 16, a 10th grader in Wellington.
Eight months earlier, public schools near Wichita had rolled out a web-based platform and curriculum from Summit Learning. The Silicon Valley-based program promotes an educational approach called “personalized learning,” which uses online tools to customize education. The platform that Summit provides was developed by Facebook engineers. It is funded by Mark Zuckerberg, Facebook’s chief executive, and his wife, Priscilla Chan, a pediatrician.
[…]
Then, students started coming home with headaches and hand cramps. Some said they felt more anxious. One child began having a recurrence of seizures. Another asked to bring her dad’s hunting earmuffs to class to block out classmates because work was now done largely alone.
“We’re allowing the computers to teach and the kids all looked like zombies,” said Tyson Koenig, a factory supervisor in McPherson, who visited his son’s fourth-grade class. In October, he pulled the 10-year-old out of the school.
In a school district survey of McPherson middle school parents released this month, 77 percent of respondents said they preferred their child not be in a classroom that uses Summit. More than 80 percent said their children had expressed concerns about the platform.
The resistance in Kansas is part of mounting nationwide opposition to Summit
[…]
Parents of special-needs students noticed problems immediately. Amy Jackson, a night-shift nurse in Wellington, has a daughter, Megan, 12, who has epilepsy and whose neurologist recommended she limit screen time to 30 minutes a day to reduce seizures. Since the school started using Summit, Megan has had seizures multiple times a day.
[…]
Some parents said they worried about their children’s data privacy.
| https://www.pinterest.com/davejbuc3 |
| My Mercies are great to all who turn to Me and to all who turn from me. How tenderly I yearn over these wayward ones. How I seek ever to save them from the hurts their very refusal of Me will bring upon them. I long to save them from the hunger of loneliness that will follow their driving away the only love that will satisfy. www.pinterest.com/davejbuc3/truth-as-we-age-it-becomes-clearer it’s 12:00PM, smile, you made it this far, don’t quit, it will make you sorry, believe you me. take it from one who has been there before. oh, and by the way, what it’s for AND about is Him, God. |
https://wordpress.com/view/the3rdonlive.wordpress.com https://www.youtube.com/watch?v=yqw9zlK-un0 – https://wordpress.com/view/the3rdonlive.wordpress.com https://www.youtube.com/watch?v=oHfNY3Ufl88 https://www.youtube.com/watch?v=aI7fe5FsgJg
ONCE AND FOR ALL, I AM NOT GOING TO TOLERATE BEING PINNED AS non hetero.
thank you. May God have mercy on your souls.
The moment we recognize our complete weakness and our complete dependence on Him will be the very moment that the Spirit of God will exhibit His power.
– Oswald Chambers –
https://www.youtube.com/watch?v=x6csBPYfOH8 https://the3rdonlive.wordpress.com/2019/08/23/if-you-only-believe-anything-is-possible-for-those-who-believe
I am among you as one that serveth.
Yes! remember to serve all. Be ready
to prove your Sonship by service. Look
on all you meet as guests in your Father’s
House, to be treated with Love, all consideration, with gentleness.
As a servant of all think no work beneath you. Be ever ready to do
all you can for others. Serve. Serve. Serve. There is a gladness in
service, a Joy in doing My Will for others, in being My expression
of all good for them.
Remember that, when you serve others, you are acting for your
Master and Lord who washed His disciples’ feet. So, in service
Efor others, express your Love for Me.
Daily Lesson
The question is not what you will do to get what you want or where you want to be. The question is what are you willing to give up? Nothing in this world is free, everything cost, money, time, or love. The three most important things in our lives. What are you willing to give up for this world, for the spiritual?
If the message in the Daily Life Lesson is not clear,
please feel free to ask for clarification or if youwish to submit a Daily Lesson please contact mehisgentletouch@gmail.com
https://wordpress.com/read/blogs/164027947/posts/1472
…. https://the3rdonlive.wordpress.com/2019/09/18/801 ….
During our times of becoming or being emotionally and mentally tired, we often focus on how to revenge ourselves from those who come after us with evil intentions. This is not the proper way in how we should handle what looks like to many of our defeat. We should never ask our FATHER in the name of JESUS to bring about harm or to quote back to HIM this scripture, [vengeance is MINE, said the LORD].
Before the crucifixion of JESUS CHRIST, those prayers that we find in the Old Testament would have been sufficient. But after the crucifixion of JESUS CHRIST, they no longer are. During the time when JESUS CHRIST walked among HIS creations, mankind. JESUS spoke and taught about being loving even to those who will come against us.
Nehemiah 4:4 Our FATHER can see clearly that the loads that we are carrying because we have not taken them to HIM, has caused us to become mentally and physically weaken, that our strength is about to fail.
Our FATHER has mercy for us, we have HIS loving-kindness, we have HIS pity. HE is not blind, HE does not turn HIS head to keep from looking at us. HE is aware that some of us are filled up with the contempt and pride of others. They ridicule us because they are arrogant and prideful. The problem is that some of us are not aware of these facts. And because of our ignorance of these facts, we do not live our lives knowing that our FATHER provides us with HIS grace because we are afflicted and humble.
LET US GET IT FINISHED; AS JESUS CHRIST/GOD FINISHED IT; YET THIS BIGGEST TRUTH; IS ABOUT AN INFERENCE TO WHO, NOT WHAT, IS THE RULER OF MY HEART, THE WORLD TO COME: HEAVEN, THE ETERNAL GIFT. A HOME FOR ALL WHO DILIGENTLY SEEK HIM, NOT him
_ Elohim (Hebrew: אֱלֹהִים [ʔɛloːˈHim’]) is The Word, The Word was God, and The Word is God. _
| Jose San Martin | Tue, Sep 24, 9:00 PM (3 hours ago) |
Daily Lesson
A house is made of bricks and wood.
A home is made of love. Let love be in
every room and in the hearts of all that
live there. Let it spread to everyone you
meet one by one and perhaps one day we
will have the world that the Lord intended.
Lord, watch over those I love, remind them
they do not walk alone and guide them with
Your gentle touch. All things work together for good, for them that love the Lord. even the tragic event whereupon this sinner was spared from the end deserved. thank God.
If the message in the Daily Life Lesson is not clear,
please feel free to ask for clarification or if you wish to submit a Daily Lesson please contact me: hisgentletouch@gmail.comt
https://the3rdonlive.wordpress.com/2019/09/25/1441
iT’S WHAT COULD BE DONE, SO THIS IS. I AM FOR
HIM WORKING ,TO ASSIST THE ONLY POWER THAT
KEPT ME ALIVE; AS TO REACH THIS POINT IN LIFE.
i am not afraid to trust in The Holy Spirit. regardless of the recent statements of “i”, and it seeming vain and self-serving, let me assure you: Such is in no way factual, i work for Him.
a sort of enthused effort to garner past viewers to come back.
and that being said all are encouraged to visit our sight on all remembered revisiting – there will be no ‘newer’ posts as of a few days ago. we had attempted to gain followers as nest as a wholesome ingredient provider can/could. all lurid posts, the mass of web-traffic seem to go the easy r0ute: seks, dogas & free stuff… “THERE ‘AIN’T NOTHING FREE, AND TOO DAMN LITTLE FOR A BUCK ANYMORE.” – well, there ya have it: the world is all consumed with the god of the air. it’s plan is for to do as you will, forgetting deserved ramifications. to those it is responded with displeasure coupled with pleasure; see… a sinful character are always welcome in Jesus’ corner, just as you are; no past behavior will be remembered, providing a sinners regret/faith is genuine. all are welcome. there is not a ticket, or ANY ‘price’ required. come as you are; He will not be fooled. GO AHEAD TRY. do enjoy His bigmercy to all.
.-.-.-.-. https://wordpress.com/block-editor/post/collactiona.live/2068 .-.-.-.-.
Mark Armstrong, The WordPress.com Blog
Mar 25, 2019
Electric Literature Moves to WordPress — Here’s How an Indie Publisher Thrives on the Open Web
Electric Literature launched 10 years ago in Brooklyn, New York, as a quarterly print journal with a mission to make literature more relevant, exciting, and inclusive. And today they’re celebrating the launch of a new website on WordPress, at electricliterature.com.
Surviving (and thriving) for ten years as an independent publisher is no small feat. Over the years the nonprofit organization has grown its online audience — with offerings like Recommended Reading and The Commuter — while expanding its membership of readers who help fund its work. The website is free to everyone and relies on the generosity of its community to donate to the site and support its mission.
How does an indie website make its business work in 2019? We talked with Electric Lit’s Executive Director Halimah Marcus about some of the lessons they’ve learned in the past 10 years.
Slow and Steady Growth Can Be a Very Good Thing Focus On Your Mission.
chineloanikpeogechukwugmailcom
Ihagh G. T.
Mar 25, 2019
👍👍👍… inspiring post, especially the longevity,10 years, which includes some other ingredients…I can see a lesson for passionate site owners: their peers ending business, especially when the initial dream was to stay in business without ever leaving. What might have halted them? Well, that would be a story for another day.
Certainly, longevity will bring about many many subscribers/membership. passionate people already have passion, so the watchwords I can perceive from your post are: “persistence, positivity and patience,” we will get there.
overbee
Mar 26, 2019
Your mission is a very important one! Keep up the great work and thank you for the inspiration.
Sarahmente
Mar 26, 2019
It’s fantastic to read that Electric Literature has been so successful while remaining true to its mission. A real inspiration to us all.
15Likes
Comments closed.
Child Of God, From The Darkness Into The Light
Dec 15, 2018
SOME OF THE POSTS DO NOT REFLECT ALL I BELIEVE IN BUT IN MOST PART THEY REFLECT MY VIEWS. MY TEACHER HIS THE HOLY SPIRIT. excellent, the best lessons are yet to come
Jonathan Caswell
Dec 18, 2018
obedience is better than sacrifice saith the Lord – HOW SO!
www.pinterest.com/davejbuc3/be-secure-in-life-know-there-is-more-than-meets-th/
Barry – Innerman
Feb 22, 2019
you are indeed a vey wonderful, and powerful woman the Lord is your strength Child Of God
Barry – Innerman
Feb 22, 2019
Thank you, God IS good
David Buckle
Cheri Lucas Rowlands, Discover
Jan 15, 2019
What Would You Do If You Could Do Anything?
What would you do if you could do anything? Tell us in the comments or in a new post.
siusanwbrownCJTCHBHeather’s Blog Spacetanishq Guptachristopherhull8442Esculenta officinalissimplyvaishvhandemaala
Load previous comments from vhandemaala and others
r3alizationz
Jan 22, 2019
If I could do anything, I would start a group of orphanages, schools, and shelters for children. All over the world.
Lexygirl Lessons: Requited Therapy
Jan 22, 2019
I would do therapy sessions in a different approach rather than the traditional red tape one. Maybe have a session with client while watching across the beach or a coffee shop rather than dreary clinic
12Likes
kennynines
kennynines
Jan 22, 2019
I would write a song, one that would fill hearts with joy and inspire people to share that joy with everyone. I would play it in coffee shops and bars for coffee and beer. I would release it directly into the public domain so anyone could play it anywhere, and the only thing I would really want from it would be to be remembered after I am gone.
Read More15Likes
Comments closed.
gthielges, gwenthielges.com
Nov 24, 2018
Just Like Joshua
Parents often repeat commands to their children for emphasis. In the first chapter of Joshua, he was told by God to “Be strong and courageous,” three times. God’s words in these verses seem to be a very matter-of-fact way of informing a willing man that the next steps must be taken, and success would not be a part of the equation if strength and courage were absent. The next steps were to obtain the land promised to the Israelites.
God’s marching orders held no promise that a supernatural feeling of courage would well up inside of Joshua’s soul. Nope. No “peace that passes understanding” feeling would signify it was time for Joshua to move. The words feel or feelings do not make an appearance in this chapter. God did not tell Joshua to feel strong and courageous. God told Joshua to be strong and courageous.
Did God promise His presence? Absolutely! But there was no promise that Joshua would not necessarily be shaking in his sandals as he carried out these sacred steps.
TerigthielgesDonna MillerSheri Traxlersusanslandry
Load previous comments from susanslandry and others
Healthy Living Mom
Healthy Living Mom
Nov 28, 2018
Thank you, Gwen, for this encouragement from Joshua. I’ve been camping out in this book for a couple of months and your words are timely. Especially, ” Courage is the strength to keep repeating to ourselves until we believe it that, “God is with me.” Thank you so much!
Healthy Living Mom
Nov 28, 2018
Thank you,
I appreciate your encouraging words! God is surely with us at all times!
Dec 6, 2018
When we rely on God’s courage and confidence,
we can accomplish anything
susan home schooling
Dec 20, 2018
So very true! Thanks for your comment!
path of life devotions, The Path of Life Daily Devotions
Jul 26, 2019
July 26, “Good”
In life there is doing “good” and being good; these things are not always found together.
A songwriter can write a good song without being a good person. A good person may be totally unable to write a good song. Go figure. Good works and goodness are not always companions.
“What Must I Do?”
Tradition calls him, “The Rich Young Ruler.” He had it all (to his way of thinking) but somewhere inside there was a void possessions and position and power did not fill. So He came to Jesus with this question:
“Good Teacher, what shall I do to inherit eternal life?”
Riverside Peace
Riverside Peace
Jul 26, 2018
Great message.
Love the song “God is so good”
Thanks for sharing
path of life devotions
Riverside Peace
Jul 26, 2018
Amen. Such a simple song with such a profound truth, Thanks for reading!
Steve
Riverside Peace
path of life devotions
Jul 26, 2018
Your welcome. I make it a habit not to ‘like’ unless I do read. If I love it, I will comment too. Have a great day.
ReplyLike
pathoflifedevotions
pathoflifedevotions
Jul 26, 2018
Means so much!
Steve
ReplyLike
David Buckle
Enter your comment here…
SEND
glastonburyeagle, We Write to Be Human
Jun 11, 2012
David
Jun 7, 2019
edharris8
edharris8
Oct 15, 2015
Might need to update your Bio…;-)
Right Now Counts Forever
the presence of Christ.
COLLACTION
Jun 24, 2019
must be,
and how exciting!
\o/
David Buckle’s, COLLACTION
Jul 6, 2019
Life’s storms
sweet barbershop? caN YOU DIG THIS? – https://youtu.be/oL1JyDTq3Qc
www.pinterest.com/davejbuc3/boards
wanna mug? https://wordpress.com/read/blogs/152707401/posts/374
see, this WHOLE EPISODE WAS THE INTENDED,recall how we figured,
| Jose San Martin | Wed, Sep 25, 9:00 PM (12 hours ago) |
you of all, took me seriously; asked how and the answer was rough?
Thank You!
Daily Lesson
The light has faded into darkness.
I have lost my way. My tears are like
the falling rain. I have lost my way.
all know someone who has, yet we
ignore them and do not reach out.
A smile, a kind word, or a helping
hand might save not only a life but a soul.
like i said: Katie’s brother kinda figured, but he was a senior; not fish friends. recall?
wordpress.com/block-editor/post/the3rdonlive.wordpress.com/1441
God help us if some yahoo’s placed in Trump’s seat, only God knows what the future. heard today’s gossip in Charlotte: “they’ll br a huge exodus from the United States if Trump loses.”
what’ll occur to this nation IF some wimpy guy, who does not know shit
check from all: us taxpayers, the less significant party hope to interrupt a businessmaster’s method of getting stuff done withOUT his commonsense notions; all except their own greed, and ambition concerned strictly their own selves. OUIR NATION is no democracy at the moment, it isn’t even a republic
when asked by a man: what sort government that the constitutional convention had formulated for the new nation, Benjamin Franklin did memorably reply: “A republic, if you can keep it”
about howto get things done… all the guppies who slid into a sweet pay
hoping to not live in a nation where the ru.ing party forgets Veterans, Social Security (justice), the rule of law. go trump; U.S.’ll be very sorry he doesn’t win.
that’s it, you need to go through the valley, just don’t stay in it.
http://www.the3rdonlive.wordpress.com
i‘swhat i can do, so i do. don’t worry
about a thing it’s going to be okay…
social media does younger kids no good, ifn’ they do not have the wisdom to peer at images and not be affected, and do not avoid such stuff. our lives are so perfidious and this country’s morals are seriously out of wack, so agreeable to eyes that are continually seeking information. interest are a good attribute for kids and teens. this world we all live in is a wondrous; yet the advertising is… well, you figure it out. once an picture gets more than a glance it is in their malleable minds.
you know when stuff goes bad and falls all apart? you do not understand why this happened not that; like: you really want something for your birthday, or whatever, dudn’t matter… anyway, feel like you’d do anything to get that Christmas gift? and don’t find it under the tree that morning? you know what you call that? we call that life; get used to it. down here we suffer, we can look above; and aim in that direction; for that is where some will be; like forever, singing all the day long thanking Him for including us regular souls that at times are acting in a sinful nature. God knew that we will have those notions to act outside the will of God, yet that is the whole reason for His cross, Jesus Christ goes in our place to suffer the punishment we all deserve.
it’ll fill our minds, in the valley… get that SPRING of the valley.
David 2 subscribers
cil of God’s Word once again. David Buckle just now the3rdonlive.wordpress.com/2019/09/18/mr-mellow peace, a relative term; what is named peace is all of our own, personal belief. air’ a super creation for us. as is the air that gives all the ability to exist; smoking messes that gift of God. think about it, it’s not only the lungs you are marring with American Indian revenge to us claiming THEIR God given lands to do so much more that it scars, burns, floods God’s home He created for us. smoking breeds cancer coating the villa that changes the air sucked into those superlative organs named lung; why would you want to go all graffiti like with the engine that is responsible for converting the breeze we create traveling in the muscular tube, conveyfood and air food from that mouth to the stomach and that in humans, about nine inches about 23 centimeters) long passing from the pharynx down the neck trachea then the spinal column and behind left bronchus where it pierces the diaphragm slightly to the left of the middle line, supplies oxygen rich blood to the cardiac organ. don’t mess with a mechanism we have no business bugging. muscular tube to convey food from the mouth to the stomach and that in humans, about nine inches or 23 centimeters long and passes from the pharynx down the neck between the trachea and the spinal column, behind bronchus for piercing es the in the left of the middle line and joins the cardiac organ the fluid that houses the soul; the blood that fuels the machine of ours. David Buckle More on WordPress.com Dr. Larry Dixon The Forgotten Third: Developing a Relationship with God our Holy Spirit; He Illuminates to believers; overemphasized? overlooked? Is the question regarding our God? Our Holy we need to answer? Art Chartier, The Peanut Gallery Saturday Morning, 06 Jul 2019 1 Peter 1:13-25 ~ Do be holy in all you do; in the Name of the Father, and of the Son, in our Holy Spirit. Amen. https://youtu.be/gdMo6QTnHrM
Peter Gibbons hates his job and the obnoxious Division VP Bill Lumbergh who has just hired two efficiency consultants to downsize the company. His best friends are two software engineers Michael Bolton and Samir Nagheenanajar, that also hate Initech, and his intrusive next door neighbor Lawrence. He believes his girlfriend Anne is cheating on him but she convinces Peter to visit the hypnotherapist Dr. Swanson. Peter tells how miserable his life is and Dr. Swanson hypnotizes him and he goes into a state of ecstasy. However, Dr. Swanson dies immediately after giving the hypnotic suggestion to Peter. Peter, in his new state, starts to date the waitress Joanna and changes his attitude which results in his being promoted by the consultants. When he discovers that Michael and Samir will be downsized, they decide to plant a virus in the banking system to embezzle fraction of cents on each financial operation into Peter’s account. However Michael commits a …
Written by –
Claudio Carvalho, Rio de Janeiro, Brazil
THIS ‘s super description
of His love for us, (U.S.: the
nation devised among those
principals of Christianity.) dig
yup, the country, this country’s
‘This Country, under God;’ see it
right there in OUR national song.
music; the voice of Angels; so true
you know what ‘m talkin’ about.
Who am i going to follow? God? you will never lose with God.
it’s not about me, it’s not about any of the fun nowadays; it’s about Him.
if you are willing to choose, you reap what you sow, you cannot be surrendered to Him beyond, you want God’s best? and are you can be forgiven – He will take you where you are, watch Him work. a forgiveness that Jesus provides all is as active for you as it is for me, and you, and them, and them; even them, them.
reflect what is true – https://collactiona.live – and shine as He does
If you want to work and they want to play, stay away.
If you want good and they want bad, stay away. If you
want a better life you; never find it by being with negative
people. Be the you that you want to be, not you that they
are. I know the friends do dope, but I do not. See the kids over
there stay away; they are dopers. I know my friends are all failing
in school, I make good grades. Those kids over there…… stay away
they are losers. It may not be fair; people are very quick to judge, that
is the world we live in. Want to be a success, hang out with smart people.
Want to have great relationship, hang out with those that have one… if you
want a better job, be with ones that have one, may be able to help you get one.
www.youtube.com/watch?v=j1a8FsHTD4U https://youtu.be/tnjL2cx4AUc
Our Lord, we know that Thou art great and able to deliver us.
I Am your deliverer. Trust in Me absolutely. Know that I will
do the very best for you. Do be ready, and willing for My Will
to be done.
Know that with Me all things are possible. Cling joyfully to that truth.
Say many times, “All things are possible with My Master, My Lord, My Friend.”
This truth, accepted and firmly believed in, is the ladder up which a
soul can climb from the lowest of pits to the elevated of heights.
If it be so, our God whom we serve; is able to deliver us from
the burning fiery furnace, He will deliver us out of thine hand, O king. Daniel 3:17
…………………………………………………………………………………………………………………………………………
August 13 – Perfection https://youtu.be/o9gK2fOq4MY?t=7 O Jesus, help us, we beseech Thee. www.youtube.com/watch?v=M_Q6ZSzV8iQ Ever your Helper through dark to Light, through weakness to Power, through sin to Salvation, through danger to Security, through poverty to Plenty, through indifference to Love, through resentment to Perfect Forgiveness. https://www.youtube.com/watch?v=6SJtqLhlELA Never be satisfied with a comparison with those around you. Ever let My words ring out. “Be ye therefore perfect even as your Father which is in Heaven is perfect.” Stop short at nothing less. https://www.youtube.com/watch?v=dOu2NpXXgiI Make it your practice, each of you, to review your character — take it in relation to life, to your dear ones, your household, friends, acquaintances, your country, your work; created with an intention to create a blog, www.christianheadlines.com/contributors/michael-foust/skillets-john-cooper-willing-to-defend-christ-if-it-costs-me-my-career.html See where I, in the same relation or circumstances or situation, should act differently. Plan how best such and such a fault can be eradicated, or such and such sin, mistake, or omission, be avoided. my weekly review – https://collactiona.live/2019/07/06/www-thankyoujesussign-org/#comment-236- at least you must have. Follow peace with all men, and holiness, without which no man shall see the Lord. Looking diligently lest any man fail of the grace of God. Hebrews 12:14,15 when we fully surrendered to the Lord Jesus it begins. WHEN YOU DO? IT WILL NOT BE TOO RECOGNIZABLE, cause: IT’S LIFE; REAL LIFE, AT IT’S BEST, BEGINS FOR YOU! be serious about your future, https://dailyencouragement.wordpress.com https://collactiona.live/2019/07/06/https-the3rdone-live-2/comment-page-1/#comment-236 www.youtube.com/watch?v=QyUpLap-VuU
The Blessing of Brokenness by Carter Conlon https://www.youtube.com/thelifeofjesus Go forward unafraid. Face each difficulty, however great and seemingly unconquerable, as you go forward towards it. The strength you will require from Me for that adventure into danger, as it may seem to you, will fortify you for its overcoming. “Fear thou not to, for I AM with thee, Be not afraid for I am thy God. I will strengthen thee, I will help thee, Yea, I will uphold thee with the right arm of My Righteousness.” “must be in the plan.” be willing to break. everyone needs breaking; as if that’s a panacea for day to day strife.God has a pathway: brokenness. www.youtube.com/watch?v=0kpJp2W6i9Y Consider Yourself Dead if Christ was willing to die for you, if you are not willing to perish, for Him, you’ve long road to travel before death. When we receive Jesus as our Savior, we no longer need to focus on our sin. Instead, we become dead to sin and receive grace to live in His righteousness. 5 min ago Go forward unafraid. Face each difficulty, however great and seemingly unconquerable, as you go forward towards it. The strength you will require from Me for that adventure into danger, as it may seem to you, will fortify you for its overcoming. “Fear thou not to, for I AM with thee, Be not afraid for I am thy God. I will strengthen thee, I will help thee, Yea, I will uphold thee with the right arm of My Righteousness.” ” MUST BE IN THE PLAN.”come see. be willing to break. everyone needs breaking; as if that’s a panacea for day to day strife.God has a pathway: brokenness. http://www.youtube.com/watch?v=0kpJp2W6i9Y ” So you also must consider yourselves dead to sin and alive to God in Christ Jesus.” Romans 6:11 Consider yourself dead. That’s a pretty striking statement. We love to talk about being “alive” in Christ. So why do I see so many Christians trudging through life powerless, purposeless, and lost in their pursuit of Jesus? great culling away those who just do not get it… hope you aren’t one such individual. what’s the scene for those prepared? in the words of a great man: “I don’t know…” neither do i, yet the sadder comparison speaks for itself: Heaven or Hell; why would you get lazy when you understand what it’s like in either one? choices, hope everyone makes a wiser decision. He desires all people to be saved in His kingdom; away from those blistering years for those who did not know Jesus while they were/are on terra firma; those who did not know Jesus while they were down here. may God bless your soul… View Post https://collactiona.live/?p=1388 Faith https://www.pinterest.com/pin/322500023303840342/?lp=true And we have known and believed the love that God hath to us.God is love; and he that dwelleth in love dwelleth in God, and God in him. John 4:16 Lord, bless us and this evening hour, and in Thy Mercy heal us all. Do not think that suffering is the only path into My Kingdom. There are sunlit glades, and ways amid the loveliest flowers, along which the steps and hearts of men are drawn to Me. There are birds and laughter and butterflies, and warm, life-giving summer air, and with these as tender companions and friends, the Joy-Way into the Kingdom can be taken. Bleak, cold, and desolate, brier-beset and stony, are not all the ways. Leave all to Me. The choice of ways, the guidance in the Way. But when the sunlight calls accept it gladly. Even in the Spirit-World appreciation results from contrary experience. Can the fireside of home be more dear than to the traveler who has forced his way over bleak moor and through blinding storm? Take to your hearts this word of cheer. “He will not suffer you to be tempted above that ye are able but will, with the temptation, also find a way of escape that ye may be able to bear it.” The world is not the Kingdom. In the world ye shall have tribulation but “be of good cheer, I have overcome the world.”
Live with Me, the Conquering Christ, and the Joy and Peace of conquest shall be yours too. https://wordpress.com/view/the3rdonlive.wordpress.com
https://www.youtube.com/watch?v=yqw9zlK-un0
……………………………………………………………………………………………………………………………………..….
weakness to Power,
sin to Salvation,
danger to Security,
through indifference to Love
Life, earth-life, is a battle.
The battle in which man will always be the .
UNLESS he summons Eternal Life-Forces to his aid.
Do this and all that has the power to thwart you slinks back defeated.
through poverty to Plenty,
Say, in the little as well as the big things of life,
“Nothing can harm,
nothing can make me afraid.
In Him I conquer.” Stand invincible, face the foes of life.
https://www.youtube.com/watch?v=vXqbTZZYNak
Many are wondering why their desire for righteousness
is not satisfied according to My Promise. But that Promise
was on condition that there should be hunger and thirst. If the
Truths I have given have not been absorbed, there can be no real
hunger for more.
So, when you miss the Joy-Light on your path, when the vision seems lost,
and the Voice silent, then ask yourself, have you failed to live out the lessons
that you were taught?
Live out My teaching in your lives, and then, hunger for more, come to Me, Bread of
Life, Food of your souls.
https://youtu.be/OLPiObt0lxA re-posting is not too genuine; but helps me spread speeches that have helped me in a pronounced way each of us, in-spite all the unwholesome actions, whether it’s spoken or acted out; we are all forgiven providing the repentance’s felt and verbalized to His gracious forgiveness. we may forbear our manifold actions. and show our robes as white, as driven snow. we should place a greeting on our souls front door, yes, us. learning the depth of forgiveness is not license to continue disregard Him in each thought word and deed; no rather a boost to our good minded intent see the light: our activity.
bless you.
https://collactiona.live/2019/09/19/septe3mber-19-151-2pm-ad
God Can Do Anything
The Collingsworth Family
God can do anything with anything
He can heal any hurt, any suffering
Every cross, every care, every burden He bare For anyone, anywhere
God can do anything
He turns nothing into something
He‘s the giver of life
He‘s hope to the hopeless
And a sight to the blind
And He makes impossible, possible
When there’s no other way
He makes the blackest sin,
white as snow.
That’s why we can say
God can do anything with anything
He can heal any hurt, any suffering
Every cross, every care, every burden He bare
For anyone, anywhere
God can do anything
The fairest of ten thousand
my soon coming King
Jehovah, Messiah reason why I sing
He’s Alpha and Omega
The Beginning and the End
My Savior and Redeemer
He‘s my closest friend
God can do anything with anything
He can… [AND WILL]
| Dear WP, |
| It’s good to know that we can give everything to Jesus. We often think about giving Him our worries, our requests. But do we think about giving Him what we’re lacking as well? David Buckle, do you ever get up in the morning and just not want [no… not really… the sun came out today, going for a walk, get some coffee .o. to… Give Smile, do good. There’s good news: Jesus can take this lack, this nothingness, this empty space, and fill it with His fullness! If this is the case for you today? Pray this prayer with me… “Lord, this morning, I feel empty, as if I have nothing to give. I want to love people, but I need You to do it through me. Fill me, Lord, with Your love, Your presence, Your joy, and Your enthusiasm. Thank You, I know that You’re doing it even now! I believe Your Word “of [Your] fullness we have all received, grace for grace.” (John 1:16 (KJV) I have Your fullness! I love You, Lord. Amen!” Thanks for existing! |
https://collactiona.live/2019/09/28/auto-draft-2
Viewing: collactiona.live
Analytics overview
New
Filters
7/20/2019 — 8/18/2019
Organic?
Paid and earned
Claimed accounts?
All Pins?
youtube?www.youtube.com/channel/UCVW-2rLA1wXXr32fmeF3bHg
Impressions not tryin’ to impress…
68.7k
85%
Total Audience neat o
43.86k
95%
Engagements WHAT? we never…
4.87k
276%
Engaged Audience whose the engaging?
4.16k
348%
Compared to previous 30 days
youtube.com/channel/UCVW-2rLA1wXXr32fmeF3bHg
Viewing: collactiona.live
7/20/2019 — 8/18/2019
Organic?
Paid and earned
Claimed accounts?
All Pins?
youtube?
Impressions not try to impress…
68.7k
85%
Total Audience neat o
43.86k
95%
Engagements WHAT? we never…
4.87k
276%
Engaged Audience whose the engager?
4.16k
348%
Compared to previous 30 days
| BE FILLED WITH THE SPIRIT THAT LOVES wordpress.com/block-editor/post/collactiona.live/1354 |
| And be not drunk with wine, wherein is excess;but be filled with the Spirit. Ephesians 5:18 Rest more with Me. If I, the Son of God, needed those times of quiet communion with My Father, away, alone, from noise, from activity, each of you then surely you need them too. Refilling with the Spirit is a need. That dwelling apart, that shutting yourself away in that secret place of your being; away alone with Me. From these times you come forth in Power to bless and heal, to Cease Rest more with Me. If I, the Son of God, needed those times of quiet with My Father, away, alone, from noise, from activity; the surely you need them too. Refilling with the Spirit is a need. That dwelling apart, in shutting yourself away in the very secret place of your being away alone with Me. From these times you come forth in Power to bless and heal. |
Because of sin, we are born separated from God. Without intervention, we are NOT eligible for Heaven. This applies to the entire human race.
You are not alone.
www.kingjamesbibleonline.org/Romans-3-23 says,
“For all have sinned, and come short of the glory of God;”
Romans 3:10 says, www.kingjamesbibleonline.org/Romans-3-10
“As it is written, There is none righteous, no, not one:”
Romans 6:23, www.kingjamesbibleonline.org/Romans-6-23
“For the wages of sin is death;”
Revelation 21:8, http://www.biblegateway.com/passage/?search=Revelation+21%3A8&version=KJV
“But the fearful, and unbelieving, and the abominable, and murderers, and whoremongers, and sorcerers, and idolaters, and all liars, shall have their part in the lake which burneth with fire and brimstone:”
There is no amount of good works we can do to save ourselves from being eternally separated from God.
Ephesians 2:8-9, http://www.bible.com/bible/1/EPH.2.8-9.KJV
“For by grace are ye saved through faith; and that not of yourselves: it is the gift of God: Not of works, lest any man should boast.”
To be separated from God forever, simply do nothing. To ignore or reject God’s son is the only sin that can keep a person out of Heaven and the only alternative to Heaven is eternal torment in the Lake of Fire (Revelation 20:15, 2 Thes. 1:7-9).
John 3:18, http://www.kingjamesbibleonline.org/John-3-18
“He that believeth on Him is not condemned: but he that believes not is condemned already, because he hath not believed in the name OF the only begotten Son of God.” https://www.youtube.com/thelifeofjesus
There is a simple and free way to be reconciled with God made possible by God’s only son Jesus. A blood sacrifice was needed to pay for your sins and Jesus was sent to become that sacrifice. He was nailed to a Roman cross to shed His blood in payment for your sin. Then three days after His death, He rose from the dead, validating once and for all His qualification to be our only Savior.
Placing your complete trust in Jesus’ death, burial and resurrection is God’s one and only means of reaching Heaven.
Jesus Christ said John 14:6, www.kingjamesbibleonline.org/John-14-6
“I am the Way, the Truth, and the Life: no man cometh unto the Father, but by Me.”
John 3:16 & 17, www.biblegateway.com/passage/?search=John+3%3A16-17
“For God so loved the world, that he gave his only begotten Son, that whosoever believeth in Him should not perish, but have everlasting life. For God sent not his Son into the world to condemn the world; but that the world through him might be saved.”
The Bible clearly tells us how to be saved:
Romans 10:9-10, www.biblegateway.com/passage/?search=Romans+10%3A9-10Romans 10:9-10
“That if thou shalt confess with thy mouth the Lord Jesus, and shalt believe in thine heart that God hath raised him from the dead, thou shalt be saved. For with the heart man believes unto righteousness; and with the mouth confession is made unto salvation.”
This is a free gift from God because He loves you.
Romans 6:23, www.biblegateway.com/passage/?search=Romans+6%3A23
“but the gift of God is eternal life through Jesus Christ our Lord.”
Romans 10:13, http://www.kingjamesbibleonline.org/Romans-10-13
“Whosoever shall call upon the name of the Lord shall be saved.”
Are you ready to believe right now? If so, simply tell God what he
asked you to confess. You might use a prayer similar to this one:
“God, I admit to you that I am a sinner, and I know I cannot do
anything to earn my way to Heaven. I truly believe that Jesus
died on the cross, was buried and rose from the grave. I put
my faith in His sacrifice to pay for my sin in full.”
www.cru.org/us/en/train-and-grow/spiritual-growth/core-christian-beliefs/heaven-and-hell.html definition; however long-winded, the best one.
What does Jesus pray when He intercedes for us? This is important to know, because in finding the answer to that question we can discover God’s plan and purpose for us. And that is the objective of prayer: to align our wills with the will of God.
In John 17 we have the greatest prayer ever prayed, which is Jesus’ prayer for us. In verse 11 Jesus prayed, “Now I am no longer in the world, but these are in the world, and I come to You. Holy Father, keep through Your name those whom You have given Me, that they may be one as We are.”
Jesus prayed for our preservation. God wants us to be strong spiritually. God want us to cross the finish line with flying colors. We all know people who have made a profession of faith and were growing so much spiritually that we may have even looked up to them as spiritual leaders. But then one day they crashed and burned. They simply walked away from the faith.
We may think,
“If someone like that fall, then maybe I could fall, too. Am I next?”
The answer to that question may surprise you:
‘it is entirely up to you.’
God does, always want to keep you, and God will keep you.
He will keep you to the end. The question is whether you want to be kept.
https://youtu.be/3Nqg36t0Pgg
https://youtu.be/bFmRY7-D6vY
https://youtu.be/FwWPL8iPB64
https://youtu.be/26_ABZSG28U
https://youtu.be/sREXLl3FiV
https://youtu.be/uyNPV3hIOGI
https://youtu.be/4fKixmVPcR8
https://youtu.be/4fKixmVPcR8
https://youtu.be/r-9L2-aVR4I
https://youtu.be/fEUyClYg0sk
https://youtu.be/cYurafmTwcw
https://youtu.be/BDUnfcuqfIA
https://youtu.be/LXL49kBROH8
https://youtu.be/KAhdu66PJjc
https://i.pinimg.com/originals/f5/a2/65/f5a26585cf9d8ae39ac4347432d4be0c.jpg
https://the3rdonlive.wordpress.com/2019/09/21/fiat/
“The Deceitfulness Of Sin”
“Sin will take you farther than you want to go,
keep you longer than you want to stay,
and cost you more than you want to pay”
Attributed to Ravi Zaccharias
Listen to our message
“But encourage one another day after day, as long as it is still called ‘Today’, so that none of you will be hardened by the deceitfulness of sin” (Hebrews 3:13).
Last Friday we shared a message titled “A Lesson From Yeast” a teaching that even a little bit of something (like yeast) can result in a lot of good or a lot of bad. The progression of a little matter becoming bigger and bigger and more and more destructive is a consequence of “the deceitfulness of sin”.
We have seen many illustrations of this in our ministry. People dabble and then dabble more, than they are caught in sin’s trap. We are always sensitive regarding confidentiality but an older recollection comes to mind going back some 15 years. I was in a small prayer group and one of the members seemed to have an earnest walk with the Lord. However he became involved with another woman who was not his wife and just crashed. Now admittedly I don’t know the specifics but likely it was a progression of bad choices that lead to his fall. His heart was hardened by the deceitfulness of sin.
The writer of Hebrews gives us a command we can all seek to obey. It’s a command for all, not a specific spiritual gift for a few. It also makes a tidy three point message:
What are we to do? “Encourage one another.” We tend to limit the meaning of the word, “encourage” in the English to be an uplifting, positive message. However the underlying Greek word Parakaleo, while certainly including this sense, has further depth and is translated in some versions “exhort”.
Biblical encouragement is an exhortation to live faithfully for the truth. An online resource states, “Parakaleo can include the idea of giving help or aid but the primary sense in the New Testament is to urge someone to take some action, especially some ethical course of action. Sometimes the word conveys the idea of comfort, sometimes of exhortation but always at the root there is the idea of enabling a person to meet some difficult situation with confidence and with gallantry.” *
When are we to do it? “Day after day, as long as it is still called ‘Today’“. I have always thought the writer might be employing some humor here demonstrating the ongoing need to encourage, after all, each current day will always be called “Today”! This verse along with Hebrews 10:23-25 is the basis of our ministry’s name “Daily Encouragement”
Why are we to do it? “So that none of you will be hardened by the deceitfulness of sin“both the encourager and the one being encouraged, similar to the Proverb that states, “Whoever refreshes others will be refreshed” (Proverbs 11:25). We must always be on our guard lest we develop a hardened heart toward spiritual truth and obedience due to the deceitfulness of sin.
The deceitfulness of sin is rampant in our world and has been ever since Satan deceived Adam and Eve in the garden. But we believe the many means of being deceived by sin is increasing, especially due to technology. May God help each of us to boldly stand firm while contending earnestly for the faith once for all delivered to the saints. We urge, exhort, and warn you to be on your guard against the heart-hardening effect of sin’s deceitfulness.
Be encouraged today,
Stephen & Brooksyne Weber
Praying manDaily prayer: Father, as believers, we are put to the test daily regarding our adherence to the Scriptures that teach right from wrong, truth from error. The Bible includes numerous examples of those who were obedient to Your laws and from those who chose to disregard them. Help us to remember that disobedience, disregard, or dilution of the Scriptures will weaken us and eventually harden our hearts to spiritual truths. We choose either to be shaped by the world or by the Word. Our will and desires cannot be shaped by both. We choose this day to be Your obedient servant no matter the consequences, for Your blessing is more to be desired than the applause of the world. Amen.
Today’s Suggested Music and Supplemental Resources
“Yes I Will” Video Vertical Worship Great song posted we yesterday and dedicated to those going through a valley but the link did not work after I posted!
For further study here’s some excellent exposition on Hebrews 3:13
Flooded road near Little Swatara Creek 7/8/19 (Phil Huber)
This morning we will be making a chaplain call to Audrey’s in
rural Lebanon County. Yesterday Phil, a friend who works there, sent me a photo of the flooding of Little Swatara Greek on the road we will be on today. We’ve had a lot of rain but it’s sup- posed to clear up today.
The apostle Paul once wrote,
It is for freedom that Christ has set us free… Do not let yourselves be burdened again by the yoke of slavery. — Galatians 5:1
He was specifically writing about those who would impose all sorts of religious rules
and human traditions on believers. But these words could also apply to personal habits
and attitudes that we allow to enslave us, weigh us down, and steal our joy. Jesus intended to set us free by His sacrifice for us on Calvary, what are those things that tie us up, that trip our feet and weigh on our hearts? Is it a habit? An addiction? A cynical heart? A hardened attitude? An unwillingness to forgive? A prejudice? Jesus died for our freedom. If we allow anything to restrict us or shackle us to a sad, mediocre life, then we are missing His great gift, paid for at such a high price.
Dear God, show me the areas in my life where I’m acting like a captive,even though You have set me completely free in Christ.
USA
the truth; never to be one who
aims for everyone to like him; a
sheer attempt is evidence you’re
a human.
| God Calling – Rejoice At Weakness Two Listeners Web Servant (8 hours ago)to me – God Calling by Two Listeners October 7 – Rejoice At Weakness Hast thou not heard, that the everlasting God, the Lord, the Creator of the ends of the earth, fainteth not, neither is weary? There is no searching of his understanding. Isaiah 40:28 Savior, breathe forgiveness o’er us. All our weakness thou dost know. Yes! I know all. Every cry for mercy. Every eye of weariness. Every plea for help. Every sorrow over failure. Every weakness. I am with you through all. My tender sympathy is yours. My strength is yours. Rejoice at your weakness, Children. My strength, made perfect in weakness. When you are weak then I am strong. Strong to help, to cure, to protect you. Trust Me, My children. I know all. I am beside you. Strong, strong, strong to save… Lean on My Love, and know that all is well.Now unto He who is able to keep you from stumbling, and to make you stand in that presence of His glory blameless with great joy, to the only God; through Jesus Christ our Lord, be His glory, majesty, dominion and authority, so before all time. now and forever. Amen. Jude 1:24-25, www.twolisteners.org …………………………………………………………………………………………………………………, ………….. AND NOW FOR SOMETHING COMPLETELY DIFFERENT ………… ……………………………………………………………………………………………………………….. ————————————————————————————— this discussion is inert; when we hint at no responses. we await counterattack, so have at it… it is a distraction to worry over the vitriol consuming the United States powers that be. recalling that the citizens voted the sitting com commander in chief in, and from what was seen is they, the voters are the working-class; the machine that keeps the United State’s gear running. all this talk they volley betwixt parties is showing the true candor of either party leaders. and it is a shame they are avoiding the problem of the fighting which does not have either’s triumph. the winners in this fight are the communists and illegal aliens raping our ways of life; the loudest casualty being our independence and liberty as one nation thAt had revolutionary conflict countering these sort of problems. no political stance would help; parties are stupid: and imagine me sounding kiddish in saying: ‘can’t we all just get along?’ no subtlety here, no bias commending either those childish tantrum throwers; yet the problem is possibly the republican fault, wonder if a donkey is tattooed on NP’s butt, she’s causing all the strife i think. the republican fella knows business, it’s a cut-throat gig where he’s not even allowed to harm an opposing party; so his hands are tied. this comment of punishing the person for spying; or treason, is tantamount to the phrase that can be taken in several ways, ‘our forefathers would be shooting by now.’ who deserves more tar in the tar and Feather party that should be be? republic noun re·pub·lic | \ ri-ˈpə-blik \ Definition of republic 1a(1): a government having chief of state who is not a monarch and in who modern times is usually a president. (2): a political unit (such as a nation) having such a form of government (3: a government in which supreme power resides in a body of citizens entitled to vote by elected officers and representatives responsible to them and governing according to law. democrat democracy noun de·moc·ra·cy | \ di-ˈmä-krə-sē \ Definition of democracy 1a: government by the people especially : rule of the majority b: a government in which the supreme power. vested in the people, exercised by directly or indirectly through the system of representation usually involving periodically held free elections 2: a political unit that has a democratic government 3 if capitalized: the principles and policies of the Democratic party in the U.S. ReplyLike |
why i’m so happy?
the Lord has full possession, the devil did/will go depart.
praise God my sins are gone. you got me into trouble,
but Jesus made me free. ‘m living, now, for Jesus.
those sins are underneath the Blood of God.
praise God, because all my sins are gone…
and tempted, and tried, all the day long…
then do we wonder why others prosper,
while sinning, cheeer up my brother, we’ll
understand it all by and by. Father of all live, i
understand why, He lends the sunshine, aft in the
sky. we’ll understand it by and by. cheer up my brother.
‘m glad my spirits are lifted each morning my orbs open. go
the be it known to all..now do let us pray Lord we have a sweet home in for
Acts chapter 4, verse number 9, examine ourselves, peer into
verse no. 2; understand that the the pharisees didn’t believe in
resurrection. this world wants to encircle us all the world’s into
the god of the air. do not look at me, look at Jesus Christ; who
God raised from the dead. He will save you today, let this be
a message of salvation. there isn no another name, in our
Heaven, but Jesus Christ. it’s a period. nothing in that
we see the boldness of Peter and John, knowing they
had been in the presence of Christ. and there was a
miracles that create boldness: “Whether it be in a
Christian; there’s a standard that will keep us in a
motive; provided that keeps you from sin? only a
believer hears Charlie Bennet. that is all for now.
“God met me with open arms”
Nina Hagen on loss experience in her childhood and youth
TIME magazine: Mrs. Hagen, when you were a child , your mother, Eva-Maria Hagen tried to kill herself.
Nina Hagen: Yes, that was a big shock abandonment. Then you suddenly see that they are not the center of life is. My mother wanted me to live alone. She must have forgotten how much she loved me. I always wanted to protect her. I had such dreams in which my mom on the road running around naked, because I wanted to say you love so much that I think it sucks that they should put on something.
TIME magazine: But your father was there for you?
Hagen: Yes, I was his one and only. But when he began to be unfaithful and being fair to deal with others, came for the first time in my life up the jealousy. Jealousy is indeed the fear that one is not loved. And this loss of experience was repeated again and again. My first love, where I thought we would get married, was also common to tell Sun
TIME magazine: Was there a rescue of this loss aversion?
Hagen: I was a child who always longed for God. Loved me and lifted to feel, not just here and now, but forever and ever. And God is with me, arms outstretched, in fact accommodated. He never said, “Oh no, Nina, you’re not good enough. From today you are no longer my daughter. “So what would never do!
TIME magazine: How did you meet him that you know so exactly what he does and what does not?
Hagen: I was 17 and wanted to know. I wanted proof of God the herbeizwingen. I have taken LSD, because I had heard that some people make it as the natural order in relation to contact with God. The result was an LSD trip, which consisted only of pain. It was hell. I was at the border between this world and the hereafter. And as I said, “Dear God, help me!” And immediately he came and said, “Nina, I am here to help you too.” And I suggested to the eye and was in a beautiful world. Peaceful bliss. And God looked me in the face. And I realized: He loves me just as I loved a man has never yet, and no man can ever love like! And then I asked him: “Are you going away again like all the others?” And he said: “I was always there, I’m always there, and I’ll be there forever.”
TIME magazine: What has made so sure that this encounter with God only an LSD hallucination was not? Sounds a bit like …
Hagen: Talk to people who had a near death experience, which tell you the same thing: there is the dimension of the eternal home.
TIME magazine: Don’t your friends say: “Nina, you’ve got a crack in the bowl”?
Hagen: Nope, they have listened interested. Because I am so authentic. But I realized that my experience really only makes sense to me. For other people this is an interesting fact report, but their faith will get you only if we build a relationship with God himself.
TIME magazine: Since you are 17, you are then lifted in God. That’s not bad.
Hagen: Yes, it was a real rescue. I have now understood that I am earthly, I do not need sexual love any more. I’m already, since my first love died, widow.I am looking for no love, love is just there. I run around and do not want to marry me again or something.
TIME magazine: So only God and love your life partner?
Hagen: Yes, my good friend, teacher, master, God, the love in person.
TIME magazine: That sounds more like the concept of life of a nun?
Hagen: Yes, I am also a nun.
TIME magazine: And since when are you a nun?
Hagen: Ever since the birth of my daughter Cosma. But even before that. If you are a nun, everything is sacred. Even the sexual relationship. The nun, yes, love is a sacred thing. That makes this not because she feels instincts, but simply because they love lives, while pregnant and child in the world brings.
TIME magazine: Normally one to believe always the doubt. Do you also doubt the existence of God?
Hagen: No, I do not know.
TIME magazine: Then you are but one exception and one lucky child!
Hagen: Yes, that’s why God has given me my voice, with which I proclaim his good news.
me too, Nina
whoever snuck the ‘s’
in fast food was a clever
little bastard. =o)
the3rdonlive.wordpress.com i try to update often…
https://www.pinterest.com/zakata/inspiring-hilarious-so-true
the time is now, as Nina
informed us all. And then
Fear not. Do not fear to be busy.
You are the servant of all. “He that
would be the greatest among you, let
him be the servant of all.”
Service is the word of My disciples. I served
indeed, the humblest, the lowliest. I was at their
command. My highest powers were at their service.
Be used. Be used by all, by the lowest, the smallest. How
best you can serve? Let that be your daily seeking, not how
best can you be served.
Look around you. Do the aims and ambitions that man strives for
bring peace, or the world’s awards bring heart-rest and happiness?
No! indeed, man is at war with man. Those whom the world has most
rewarded, with name, fame, honor, wealth, are weary and disappointed.
And yet, to the listening ear, above the jangle of the world’s discordant cries,
there echoes down the 1900 years My message, “Come unto Me, all weary and
heavy laden and I will give you rest.”
And the weary and disappointed who listen and turn to Me find indeed that rest. Joy of
the Weary I am, Music to the Heart I am, Health to the Sick, Wealth to the Poor, Food to the
Hungry, Home to the Wanderer,
Rapture to the Jaded, Love to the Lonely.
There is not one want of the soul that I do not supply for the asking, and to you too, I long to be all.
Therefore will the Lord wait, that he may be gracious unto you. – Isaiah 30:18
