https://the3rdonlive.wordpress.com/2019/09/25/1441
https://the3rdonlive.wordpress.com/2019/09/25/there-is-no-fear-in-love-perfect-love-casts-out-fear-because-fear-hath-torment-it-is-he-that-fears-thats-made-perfect-in-love-2/
AND NOW FOR COMPLETELY DIFFERENT
https://wordpress.com/read/blogs/158915175/posts/3174#comments
Discussion on The Federalist https://www.pinterest.com/davejbuc3
Poll Finds More Young Americans Think Well Of Socialism, Communism
David 2 days ago https://en.gravatar.com/davidb48 – https://www.youtube.com/watch?v=M_Q6ZSzV8iQ –
https://wordpress.com/block-editor/post/the3rdonlive.wordpress.com/2200
well, not going to soil this immediate mind by reading other’s additions,
youth will be the future; IF they understand that said future is their future
they might consider reality, not the boob-tube’s media folly. the effort to
change the current power that is will only arrive with inexperienced vote.
young opinions are marked with an almost deadly self opinion. think of it
from those who have been there before in a not so similar situation, but it
just doesn’t matter. socialism generates sadness, more as it morphs into
communism. socialism is communism with Christmas lights. it may seem
so innocent, presents in view, but nothing, but nothing’s free on this globe.
the piper WILL be paid. think of the things you will lose, with that free
ride they like to voice to the uninformed, are full of energy for a personal
assumed gift. that gift will cost in the future, maybe not in the short sight,
but believe it. it will come from the rear. biting every liberty and freedom you
think will last forever. hint: nothing lasts forever; barring the Word of God. dig it.
let us not remember, and spout out, history. it’s bunk, nice to recall, but not to return. DO NOW.
actions, not words…
the future is owned by the youth of America. said group of citizens be seeing all
the joys you experience now. that free ride will cost you young adults your future.
Edit
View in discussion
Discussion on
About Jesus.net
7 comments
God is TRULY worthy of praise!
David 2 days ago Edit View in discussion David 2 days ago
Gentle Touch
Inboxx
Jose San Martin 9:01 PM (20 minutes ago)
to HGT
Daily Lesson
Consider the advice of your elders not
because they are always right but because
of the wisdom they have gleaned from
being wrong…Native American quote
As you look back on your younger years
the number of times you thought your
parents were wrong are now echos that
you hear when you try to tell your
children what to do. Remember, you are
never too old to learn from someone even
a few days older than you and never so
old you can not teach someone a few
days younger.
Edit
View in discussion
David
6 days ago
worldwide posting, no cost, only encouragement would be realizing how
late it really is to NOT believe. you will not lose if “TO” is your decision…
https://en.gravatar.com/dav… – https://wordpress.com/view/… Edit View in discussion David 7 days ago
glad to be back ya’ll!
https://jesus.net
https://collactiona.live
Edit
View in discussion
David
5 months ago
https://dailyps.com/conside… as a doornail. View in discussion Discussion on newsCafe 41 comments
#MOSCOWMITCHISNEXT TRENDS AFTER REPUBLICAN MATT…
David 6 days ago Pending
Trump 2020 – otherwise we’re headed for socialism;
which IS communism with out Christmas decortuion
Discussion on
About Jesus.net
3 comments
Watch The Case For Christ
https://the3rdonlive.wordpress.com/ Edit View in discussion Discussion on Brighteon.com 1 comments
Govt Health Care Is About To Implode – Brighteon
the views and the opinions expressed in
https://collactiona.live/o9d DO represent
the views/ideas/beliefs of David Buckle… View in discussion Discussion on About Jesus.net 4 comments
Do you want to please God?
DavidCharlotte Christine Roman 5 months ago as am i View in discussion Discussion on Dailyps 8 comments
Consider Yourself Dead
USMC
Make the most of every opportunity for doing good in these evil days. — Ephesians 5:16
We must buy up the opportunities we have before the night comes. This is the day of opportunity. Our church took a survey of two thousand women in our community to find out what they were thinking, and how our women’s ministry could best meet their needs. Out of all of those interviewed, only a handful of women were hostile or refused to talk with us. We need to buy up the opportunities with the many who are interested and searching.
Colossians 4:5 tells us to “live wisely among those who are not Christians, and make the most of every opportunity.” Paul goes on to explain that in this wise walk, our speech must be salty (there will be a tang to it) so that we may know how to answer every person. Making the most of every opportunity means cultivating the “know-how” of argument and debate. Making the most of every opportunity means that by our very lifestyle, we will engender some questions from others.
Once in a train full of rowdy, drunken football fans, a young Christian was sitting quietly, reading. An old gentleman, observing first the drunks and then the young man, said to him, “You seem to have found the secret to life—do you want to share it?” Our young friend lost no time “making the most of the opportunity”!
We must ask God for a great sense of urgency so that we can make the most of every opportunity to serve and share him.
For further study: Ephesians 5:15-20
He does the picking and choosing; maybe ones character and behavior matter.
when will we ACT not talk
AND NOW
now
antein
we’re not up to par; God help us. C. Taylor! Top barber of central NC
shave and a hair cut; WAS two bits
http://www.dfphoto.com 
www.quickflashgames.comgames/brickbreak 
oh Jen. 
AMEN
God can do anything
https://the3rdonlive.wordpress.com/2019/09/25/there-is-no-fear-in-love-perfect-love-casts-out-fear-because-fear-hath-torment-it-is-he-that-fears-thats-made-perfect-in-love-2/
“God Has No Rival!”
- posted on Daily Encouragement:
- “God Has No Rival!”
- A view looking up Kraybill Church Road from our driveway. “God Has No Rival!”
- www.youtube.com/watch?v=0kpJp2W6i9Y –
New Post
- Stephen C. Weber“Changes, Challenges And Choices”
- Message summary: Today we will consider changes, challenges and choices. Listen to this message on your audio player.
- “Choose for yourselves this day whom you will serve, whether the gods your ancestors served beyond the Euphrates, or the gods of the Amorites, in whose land you are Which of course elicits a number of responses. Bunny then says,
- “Today is the day God has given me the opportunity to tell you that Jesus loves you!”Yesterday he went along with us for our chaplain visits, especially looking for opportunities to minister to truck drivers. Our first company yesterday receives many containers from a port and Bunny is seeking ways to share God’s love with these drivers.At this company we have the opportunity to share a brief devotional message early each Tuesday morning so yesterday I asked Bunny to share. He shared that we all have changes, challenges and choices in life which prompted today’s study.Some 3,400 years ago Joshua gave his final challenge to the children of Israel. He had lived his life in steadfast commitment to God. He’s first mentioned in Scripture as the trusted commander of Moses’ army shortly after they crossed the Red Sea during the Exodus. He, along with Caleb, was one of only two spies to bring back a faith-filled report that essentially said, “With God’s help we can do it!”Joshua had faithfully served under Moses during the 40-year period in the wilderness and had led God’s people in the conquest for some 25 years. He’s now 110 years old and musters enough strength for a final challenge to faith and commitment that rings through the ages.The people were experiencing three C’s that people all though the ages have dealt with.
- 1) Changes – The Israelites had entered the promised land under Joshua’s leadership but now were about to experience a change. Things weren’t going to stay the same; there would soon be new leadership. We go through many changes throughout the course of our lives; some major, even life-transforming, others smaller. Most of us really don’t know what change we will encounter today, but great assurance can fill our hearts when we remember that God said “I the Lord do not change” (Malachi 3:6). He is a steady presence in our life, the anchor for our faith when all other ground is sinking sand. Thomas Chisolm reminds us that we can rely on our unchanging God in the hymn classic, Great Is Thy Faithfulness: “Thou changest not, Thy compassions, they fail not. As Thou hast been Thou forever wilt be.”
- 2) Challenges – Changes often bring on challenges. Although the people had entered the promised land many challenges lay ahead for them. Just keep reading and you’ll see one challenge after the other! In our lives changes usually bring challenges as well and just like the Israelites we will receive blessing when we obey God.
- Choices – Usually there are choices we must make as a result of changes and challenges, and that makes life hard. Today we will all make many, many choices. Life is just full of choices and decision-making, from tiny daily choices such as what brand of soap to purchase or what to eat for dinner to major, life altering decisions such as our choice for a mate or career. Many choices do not have moral consequences but many others are a choice between right and wrong. “There is a way that seems right to a man, but in the end it leads to death” (Proverbs 14:12). However there is one fundamental choice we all share, based upon today’s portion of Scripture in the Old Testament. Joshua set the fundamental choice clearly before the people with these words, “Choose for yourselves this day whom you will serve”. In the context of Joshua’s challenge their fundamental choice was between serving the one true God and “the gods your ancestors served beyond the Euphrates, or the gods of the Amorites, in whose land you are living.”In a broader sense the choice now and for every generation is whether we serve the one true God or “the god of this world” (2 Corinthians 4:4). Even those who practice the faith of atheism are essentially serving the god of this world. People then and now have this fundamental choice, for the one true God does not force people to love and serve Him.Joshua sets a great example for the people of his time and through all subsequent ages, including our own. Let us proclaim this day, “As for me and my house, we will serve the Lord!”
- Be encouraged today,
- Daily prayer: Father, You have drawn us with an everlasting love; You show us Your loving kindness day after day. Your bountiful provision gives to us material, physical and spiritual blessings that only a caring heavenly Father can give. But even though our cup overflows with Your goodness we face changes and challenges amidst our blessing. As we deal with the inevitable changes and the subsequent challenges that follow help us to make the life defining choice, like Joshua, and declare to all who will hear,
- “As for me and my house we will serve the Lord.”
wisdom
https://wordpress.com/view/collactiona.live
https://youtu.be/Hj_hyBEgOJ0
https://youtu.be/LgXt9YVr94U
their circumstances
for what they are
I do not believe in
circumstances.
The people who get on in
in this world are the people
who get up and look for the
circumstances they wan,
and, if they can’t find them,
make them.”
George Bernard Shaw (1865-1950)
https://youtu.be/LgXt9YVr94U
Yea, what he said
http://WWW.DFPHOTO.COM https://www.youtube.com/watch?v=57Aar_jPem0 https://youtu.be/d-9-AcHNVM4 
https://youtu.be/Hj_hyBEgOJ0 
https://youtu.be/See-Qwor0oQ 
https://images.app.goo.gl/8E3mN6gvSjuJ36Nh6 
https://youtu.be/fpFfYNO8r6o 
https://collactiona.live/2019/08/26/o0 
https://youtu.be/iReD_5-96Hs 
https://youtu.be/os6zduqJM40 
https://collactiona.live/2019/08/26/o0 
https://collactiona.live/2019/08/26/o0/
https://images.app.goo.gl/8E3mN6gvSjuJ36Nh6
https://www.youtube.com/watch?v=RPRsTrQA0cU
https://the3rdonlive.wordpress.com/2019/10/22/1933
could be, should be, so it is now :.)
saved to be secure in life, know there is more than meets the eye
https://www.youtube.com/user/Godiswithusfull TRUST GOD ALWAYS
% God Does Not Want You To Try Harder, He Wants You To Trust Him %
SOMEONE DID THIS
https://www.youtube.com/watch?v=ME4IaxGwNTo
thank you; much.
invitations are not only said
To those who know Me not, there is in Me nothing to appeal to them, or to attract them.
Those who know Me there is nothing more to be desired.
“No beauty they could desire Him.”
Oh! My children, draw very near to Me. See Me as I really am,
that ever you may have the Joy of finding in Me all you could desire.
The fulfillment of all you could desire in Master, Lord, or Friend.
such is the this case here, my friend, ‘m not upset…
All Are called… few RSVP, huh?
https://youtu.be/b3PwozgRtHQ
https://youtu.be/b3PwozgRtHQ
FEAR NOT
And the work of righteousness shall be peace; and the effect of righteousness quietness and assurance for ever.
— Isaiah 32:17.
Be still and know that I am God. Only when a soul attains this calm can there be true work done, and mind and soul and body be strong to conquer and to bear.
The Peace is the work of righteousness — living the right life, living with Me. Quietness and assurance follow.
Assurance is the calm born of a deep certainty in Me, in My Promise, in My Power to save and keep. Gain this calm, and at all costs keep this calm. Rest in Me. Live in Me. Calm, quiet, assured — at Peace.
Elect according to the foreknowledge of God the Father,
through sanctification of the Spirit, … Grace unto
you, an
September 29 I Touch Your Arm And besought him that they might only touch the hem of his garment; and as many as touched were made perfectly whole. Matthew 14:36 Thy touch has still its ancient Power Yes! when you are quiet before Me I lay My Hand upon each head, and Divine Spirit flows through that healing, powerful Touch into your very beings. Wait in silence before Me to feel that. When you look to Me for guidance My Hand is laid upon your arm, a gentle Touch to point the way. When in mental, physical, or spiritual weakness you cry to Me for healing, My Touch brings Strength and Healing, the renewal of your youth, the power to climb and strive. When you faint by the way, and stumbling footsteps show human strength is waning, My Touch of the Strong and Helping Hand supports you on your Way. Yes! My Children, My touch has still its ancient Power and that Power is promised to you. So go forward into the future bravely and unafraid.Draft
sadness…
For many years, Silicon Valley parents (aka tech inventors) have been sending their kids to private low-tech schools and limiting their use of tech, whereas other American families are being told that providing “high tech” educations is what’s best for their kids. An increasing number of experts and studies continue to warn that this is definitely NOT best for kids (see 1, 2, 3), and it’s not just about eye damage (see 1, 2) from excessive screen use.
When students at a private school in Australia were given a choice between a high-tech education or no-tech education, they chose no-tech. When American families aren’t given a choice, some are removing their kids from schools. From The New York Times:
The seed of rebellion was planted in classrooms. It grew in kitchens and living rooms, in conversations between students and their parents.
It culminated when Collin Winter, 14, an eighth grader in McPherson, Kan., joined a classroom walkout in January. In the nearby town of Wellington, high schoolers staged a sit-in. Their parents organized in living rooms, at churches and in the back of machine repair shops. They showed up en masse to school board meetings. In neighborhoods with no political yard signs, homemade signs with dark red slash marks suddenly popped up.
Silicon Valley had come to small-town Kansas schools — and it was not going well.
“I want to just take my Chromebook back and tell them I’m not doing it anymore,” said Kallee Forslund, 16, a 10th grader in Wellington.
Eight months earlier, public schools near Wichita had rolled out a web-based platform and curriculum from Summit Learning. The Silicon Valley-based program promotes an educational approach called “personalized learning,” which uses online tools to customize education. The platform that Summit provides was developed by Facebook engineers. It is funded by Mark Zuckerberg, Facebook’s chief executive, and his wife, Priscilla Chan, a pediatrician.
[…]
Then, students started coming home with headaches and hand cramps. Some said they felt more anxious. One child began having a recurrence of seizures. Another asked to bring her dad’s hunting earmuffs to class to block out classmates because work was now done largely alone.
“We’re allowing the computers to teach and the kids all looked like zombies,” said Tyson Koenig, a factory supervisor in McPherson, who visited his son’s fourth-grade class. In October, he pulled the 10-year-old out of the school.
In a school district survey of McPherson middle school parents released this month, 77 percent of respondents said they preferred their child not be in a classroom that uses Summit. More than 80 percent said their children had expressed concerns about the platform.
The resistance in Kansas is part of mounting nationwide opposition to Summit
[…]
Parents of special-needs students noticed problems immediately. Amy Jackson, a night-shift nurse in Wellington, has a daughter, Megan, 12, who has epilepsy and whose neurologist recommended she limit screen time to 30 minutes a day to reduce seizures. Since the school started using Summit, Megan has had seizures multiple times a day.
[…]
Some parents said they worried about their children’s data privacy.
Photo Gallery
Websites
- collactiona.live as apposed to die
- wisdom
- Jesus.net
- be broken
- www.youtube.com/watch?v=0kpJp2W6i9Y
- collactiona
- YOU ARE
- think about it; today
- think about it.2
- disturbing
- JC – say it often, see what goes on…
David Buckle
https://www.youtube.com/watch?v=vM9-e3tFN6I&feature=youtu.be
He works, trust .
| https://www.pinterest.com/davejbuc3 |
| My Mercies are great to all who turn to Me and to all who turn from me. How tenderly I yearn over these wayward ones. How I seek ever to save them from the hurts their very refusal of Me will bring upon them. I long to save them from the hunger of loneliness that will follow their driving away the only love that will satisfy. www.pinterest.com/davejbuc3/truth-as-we-age-it-becomes-clearer it’s 12:00PM, smile, you made it this far, don’t quit, it will make you sorry, believe you me. take it from one who has been there before. oh, and by the way, what it’s for AND about is Him, God. |
https://wordpress.com/view/the3rdonlive.wordpress.com https://www.youtube.com/watch?v=yqw9zlK-un0 – https://wordpress.com/view/the3rdonlive.wordpress.com https://www.youtube.com/watch?v=oHfNY3Ufl88 https://www.youtube.com/watch?v=aI7fe5FsgJg
ONCE AND FOR ALL, I AM NOT GOING TO TOLERATE BEING PINNED AS non hetero.
thank you. May God have mercy on your souls.
The moment we recognize our complete weakness and our complete dependence on Him will be the very moment that the Spirit of God will exhibit His power.
– Oswald Chambers –
https://www.youtube.com/watch?v=x6csBPYfOH8 https://the3rdonlive.wordpress.com/2019/08/23/if-you-only-believe-anything-is-possible-for-those-who-believe
I am among you as one that serveth.
Yes! remember to serve all. Be ready
to prove your Sonship by service. Look
on all you meet as guests in your Father’s
House, to be treated with Love, all consideration, with gentleness.
As a servant of all think no work beneath you. Be ever ready to do
all you can for others. Serve. Serve. Serve. There is a gladness in
service, a Joy in doing My Will for others, in being My expression
of all good for them.
Remember that, when you serve others, you are acting for your
Master and Lord who washed His disciples’ feet. So, in service
Efor others, express your Love for Me.
P
Daily Lesson
The question is not what you will do to get what you want or where you want to be. The question is what are you willing to give up? Nothing in this world is free, everything cost, money, time, or love. The three most important things in our lives. What are you willing to give up for this world, for the spiritual?
If the message in the Daily Life Lesson is not clear,
please feel free to ask for clarification or if youwish to submit a Daily Lesson please contact mehisgentletouch@gmail.com
https://wordpress.com/read/blogs/164027947/posts/1472
…. https://the3rdonlive.wordpress.com/2019/09/18/801 ….
The question is not what you will do to
get what you want or where you want to
be. The question is what are you willing
to give up? Nothing in this world is free,
everything cost, money, time, or love.
The three most important things in our lives.
What are you willing to give up for this world,
for the spiritual?
If the message in the Daily Life Lesson is not clear,
feel free to ask for clarification and IF you
wish to submit a Daily Lesson please contact me
hisgentletouch@gmail.com
wordpress.com/read/feeds/78716935
During our times of becoming or being emotionally and mentally tired, we often focus on how to revenge ourselves from those who come after us with evil intentions. This is not the proper way in how we should handle what looks like to many of our defeat. We should never ask our FATHER in the name of JESUS to bring about harm or to quote back to HIM this scripture, [vengeance is MINE, said the LORD].
Before the crucifixion of JESUS CHRIST, those prayers that we find in the Old Testament would have been sufficient. But after the crucifixion of JESUS CHRIST, they no longer are. During the time when JESUS CHRIST walked among HIS creations, mankind. JESUS spoke and taught about being loving even to those who will come against us.
Nehemiah 4:4 Our FATHER can see clearly that the loads that we are carrying because we have not taken them to HIM, has caused us to become mentally and physically weaken, that our strength is about to fail.
Our FATHER has mercy for us, we have HIS loving-kindness, we have HIS pity. HE is not blind, HE does not turn HIS head to keep from looking at us. HE is aware that some of us are filled up with the contempt and pride of others. They ridicule us because they are arrogant and prideful. The problem is that some of us are not aware of these facts. And because of our ignorance of these facts, we do not live our lives knowing that our FATHER provides us with HIS grace because we are afflicted and humble.
https://youtu.be/jlFXhigvTvM
https://www.youtube.com/watch?v=AZQxH_8raCI
warned all that time is shorter than we think
Americans died for this flag
There is no fear in love, Perfect love casts out fear. because fear hath torment. it is he that fears that’s made perfect in love. …………………………………………… 1 John 4:18
LET US GET IT FINISHED; AS JESUS CHRIST/GOD FINISHED IT; YET THIS BIGGEST TRUTH; IS ABOUT AN INFERENCE TO WHO, NOT WHAT, IS THE RULER OF MY HEART, THE WORLD TO COME: HEAVEN, THE ETERNAL GIFT. A HOME FOR ALL WHO DILIGENTLY SEEK HIM, NOT him
El
Elohim
_ Elohim (Hebrew: אֱלֹהִים [ʔɛloːˈHim’]) is The Word, The Word was God, and The Word is God. _
- God-realization.
- Involution.
- Mast.
- Mandali.
- New Life.
- many will come in My name, many will be deceived, keep your hearts pure, away from sin.
- https://www.youtube.com/watch?v=oZKv130BT2A Christian Brothers still in the world.
| Jose San Martin | Tue, Sep 24, 9:00 PM (3 hours ago) |
Daily Lesson
A house is made of bricks and wood.
A home is made of love. Let love be in
every room and in the hearts of all that
live there. Let it spread to everyone you
meet one by one and perhaps one day we
will have the world that the Lord intended.
Lord, watch over those I love, remind them
they do not walk alone and guide them with
Your gentle touch. All things work together for good, for them that love the Lord. even the tragic event whereupon this sinner was spared from the end deserved. thank God.
If the message in the Daily Life Lesson is not clear,
please feel free to ask for clarification or if you wish to submit a Daily Lesson please contact me: hisgentletouch@gmail.comt
https://the3rdonlive.wordpress.com/2019/09/25/1441
iT’S WHAT COULD BE DONE, SO THIS IS. I AM FOR
HIM WORKING ,TO ASSIST THE ONLY POWER THAT
KEPT ME ALIVE; AS TO REACH THIS POINT IN LIFE.
i am not afraid to trust in The Holy Spirit. regardless of the recent statements of “i”, and it seeming vain and self-serving, let me assure you: Such is in no way factual, i work for Him.
a sort of enthused effort to garner past viewers to come back.
updated; as are most of the pages Lee puts up
and that being said all are encouraged to visit our sight on all remembered revisiting – there will be no ‘newer’ posts as of a few days ago. we had attempted to gain followers as nest as a wholesome ingredient provider can/could. all lurid posts, the mass of web-traffic seem to go the easy r0ute: seks, dogas & free stuff… “THERE ‘AIN’T NOTHING FREE, AND TOO DAMN LITTLE FOR A BUCK ANYMORE.” – well, there ya have it: the world is all consumed with the god of the air. it’s plan is for to do as you will, forgetting deserved ramifications. to those it is responded with displeasure coupled with pleasure; see… a sinful character are always welcome in Jesus’ corner, just as you are; no past behavior will be remembered, providing a sinners regret/faith is genuine. all are welcome. there is not a ticket, or ANY ‘price’ required. come as you are; He will not be fooled. GO AHEAD TRY. do enjoy His bigmercy to all.
.-.-.-.-. https://wordpress.com/block-editor/post/collactiona.live/2068 .-.-.-.-.
Mark Armstrong, The WordPress.com Blog
Mar 25, 2019
Electric Literature Moves to WordPress — Here’s How an Indie Publisher Thrives on the Open Web
Electric Literature launched 10 years ago in Brooklyn, New York, as a quarterly print journal with a mission to make literature more relevant, exciting, and inclusive. And today they’re celebrating the launch of a new website on WordPress, at electricliterature.com.
Surviving (and thriving) for ten years as an independent publisher is no small feat. Over the years the nonprofit organization has grown its online audience — with offerings like Recommended Reading and The Commuter — while expanding its membership of readers who help fund its work. The website is free to everyone and relies on the generosity of its community to donate to the site and support its mission.
How does an indie website make its business work in 2019? We talked with Electric Lit’s Executive Director Halimah Marcus about some of the lessons they’ve learned in the past 10 years.
Slow and Steady Growth Can Be a Very Good Thing Focus On Your Mission.
chineloanikpeogechukwugmailcom
Ihagh G. T.
Mar 25, 2019
👍👍👍… inspiring post, especially the longevity,10 years, which includes some other ingredients…I can see a lesson for passionate site owners: their peers ending business, especially when the initial dream was to stay in business without ever leaving. What might have halted them? Well, that would be a story for another day.
Certainly, longevity will bring about many many subscribers/membership. passionate people already have passion, so the watchwords I can perceive from your post are: “persistence, positivity and patience,” we will get there.
overbee
Mar 26, 2019
Your mission is a very important one! Keep up the great work and thank you for the inspiration.
Sarahmente
Mar 26, 2019
It’s fantastic to read that Electric Literature has been so successful while remaining true to its mission. A real inspiration to us all.
15Likes
Comments closed.
Child Of God, From The Darkness Into The Light
Dec 15, 2018
SOME OF THE POSTS DO NOT REFLECT ALL I BELIEVE IN BUT IN MOST PART THEY REFLECT MY VIEWS. MY TEACHER HIS THE HOLY SPIRIT. excellent, the best lessons are yet to come
Jonathan Caswell
Dec 18, 2018
obedience is better than sacrifice saith the Lord – HOW SO!
www.pinterest.com/davejbuc3/be-secure-in-life-know-there-is-more-than-meets-th/
Barry – Innerman
Feb 22, 2019
you are indeed a vey wonderful, and powerful woman the Lord is your strength Child Of God
Barry – Innerman
Feb 22, 2019
Thank you, God IS good
David Buckle
Cheri Lucas Rowlands, Discover
Jan 15, 2019
What Would You Do If You Could Do Anything?
What would you do if you could do anything? Tell us in the comments or in a new post.
siusanwbrownCJTCHBHeather’s Blog Spacetanishq Guptachristopherhull8442Esculenta officinalissimplyvaishvhandemaala
Load previous comments from vhandemaala and others
r3alizationz
Jan 22, 2019
If I could do anything, I would start a group of orphanages, schools, and shelters for children. All over the world.
Lexygirl Lessons: Requited Therapy
Jan 22, 2019
I would do therapy sessions in a different approach rather than the traditional red tape one. Maybe have a session with client while watching across the beach or a coffee shop rather than dreary clinic
12Likes
kennynines
kennynines
Jan 22, 2019
I would write a song, one that would fill hearts with joy and inspire people to share that joy with everyone. I would play it in coffee shops and bars for coffee and beer. I would release it directly into the public domain so anyone could play it anywhere, and the only thing I would really want from it would be to be remembered after I am gone.
Read More15Likes
Comments closed.
gthielges, gwenthielges.com
Nov 24, 2018
Just Like Joshua
Parents often repeat commands to their children for emphasis. In the first chapter of Joshua, he was told by God to “Be strong and courageous,” three times. God’s words in these verses seem to be a very matter-of-fact way of informing a willing man that the next steps must be taken, and success would not be a part of the equation if strength and courage were absent. The next steps were to obtain the land promised to the Israelites.
God’s marching orders held no promise that a supernatural feeling of courage would well up inside of Joshua’s soul. Nope. No “peace that passes understanding” feeling would signify it was time for Joshua to move. The words feel or feelings do not make an appearance in this chapter. God did not tell Joshua to feel strong and courageous. God told Joshua to be strong and courageous.
Did God promise His presence? Absolutely! But there was no promise that Joshua would not necessarily be shaking in his sandals as he carried out these sacred steps.
TerigthielgesDonna MillerSheri Traxlersusanslandry
Load previous comments from susanslandry and others
Healthy Living Mom
Healthy Living Mom
Nov 28, 2018
Thank you, Gwen, for this encouragement from Joshua. I’ve been camping out in this book for a couple of months and your words are timely. Especially, ” Courage is the strength to keep repeating to ourselves until we believe it that, “God is with me.” Thank you so much!
Healthy Living Mom
Nov 28, 2018
Thank you,
I appreciate your encouraging words! God is surely with us at all times!
Dec 6, 2018
When we rely on God’s courage and confidence,
we can accomplish anything
susan home schooling
Dec 20, 2018
So very true! Thanks for your comment!
path of life devotions, The Path of Life Daily Devotions
Jul 26, 2019
July 26, “Good”
In life there is doing “good” and being good; these things are not always found together.
A songwriter can write a good song without being a good person. A good person may be totally unable to write a good song. Go figure. Good works and goodness are not always companions.
“What Must I Do?”
Tradition calls him, “The Rich Young Ruler.” He had it all (to his way of thinking) but somewhere inside there was a void possessions and position and power did not fill. So He came to Jesus with this question:
“Good Teacher, what shall I do to inherit eternal life?”
Riverside Peace
Riverside Peace
Jul 26, 2018
Great message.
Love the song “God is so good”
Thanks for sharing
path of life devotions
Riverside Peace
Jul 26, 2018
Amen. Such a simple song with such a profound truth, Thanks for reading!
Steve
Riverside Peace
path of life devotions
Jul 26, 2018
Your welcome. I make it a habit not to ‘like’ unless I do read. If I love it, I will comment too. Have a great day.
ReplyLike
pathoflifedevotions
pathoflifedevotions
Jul 26, 2018
Means so much!
Steve
ReplyLike
David Buckle
Enter your comment here…
SEND
glastonburyeagle, We Write to Be Human
Jun 11, 2012
David
Jun 7, 2019
edharris8
edharris8
Oct 15, 2015
Might need to update your Bio…;-)
Right Now Counts Forever
the presence of Christ.
https://www.pinterest.com/davejbuc3/7132019-132pm
COLLACTION
Jun 24, 2019
must be,
and how exciting!
\o/
David Buckle’s, COLLACTION
Jul 6, 2019
Life’s storms
If you want 9/7/19 10:00PM
TWO LISTENERS
be ready to go
be ready to go
https://guns-are-my-friend.tumblr.com/image/17038158400
https://the3rdonlive.wordpress.com/2019/09/22/thank-you-happiness-engineer-2
sweet barbershop? caN YOU DIG THIS? – https://youtu.be/oL1JyDTq3Qc
www.pinterest.com/davejbuc3/boards
wanna mug? https://wordpress.com/read/blogs/152707401/posts/374
see, this WHOLE EPISODE WAS THE INTENDED,recall how we figured,
| Jose San Martin | Wed, Sep 25, 9:00 PM (12 hours ago) |
you of all, took me seriously; asked how and the answer was rough?
Thank You!
Daily Lesson
The light has faded into darkness.
I have lost my way. My tears are like
the falling rain. I have lost my way.
all know someone who has, yet we
ignore them and do not reach out.
A smile, a kind word, or a helping
hand might save not only a life but a soul.
www.today.com/home/5-things-know-about-caring-your-american-flag-how-retire-t131692
https://youtu.be/HVzpDl7Ale8 this goes out to you, Kim. https://youtu.be/uS90B4sZf7U
like i said: Katie’s brother kinda figured, but he was a senior; not fish friends. recall?
https://www.youtube.com/watch?v=bS7Ityj6KmM
https://youtu.be/bsDv5OHbirg
https://www.youtube.com/watch?v=bsDv5OHbirg
the3rdonlive.wordpress.com
allot like we, well… at least me. are so capricious with God’s Law.
https://wordpress.com/block-editor/post/the3rdonlive.wordpress.com/1441
https://biblehub.com/kjv/matthew/22-40.htm
wordpress.com/block-editor/post/the3rdonlive.wordpress.com/1441
https://www.pinterest.com/davejbuc3/honor/
https://www.pinterest.com/pin/355362226844472921/
ya know, people whine a out OUR PRESIDENT, jealousy’s a bitch.
God help us if some yahoo’s placed in Trump’s seat, only God knows what the future. heard today’s gossip in Charlotte: “they’ll br a huge exodus from the United States if Trump loses.”
what’ll occur to this nation IF some wimpy guy, who does not know shit
check from all: us taxpayers, the less significant party hope to interrupt a businessmaster’s method of getting stuff done withOUT his commonsense notions; all except their own greed, and ambition concerned strictly their own selves. OUIR NATION is no democracy at the moment, it isn’t even a republic
when asked by a man: what sort government that the constitutional convention had formulated for the new nation, Benjamin Franklin did memorably reply: “A republic, if you can keep it”
about howto get things done… all the guppies who slid into a sweet pay
hoping to not live in a nation where the ru.ing party forgets Veterans, Social Security (justice), the rule of law. go trump; U.S.’ll be very sorry he doesn’t win.
https://guns-are-my-friend.tumblr.com/post/187060492296/cwwhite75-hahahahaha
https://youtu.be/1vrEljMfXYo
Psalm 104
https://the3rdonlive.wordpress.com/2019/10/21/wisdom
https://youtu.be/d-9-AcHNVM4
that’s it, you need to go through the valley, just don’t stay in it.
http://www.the3rdonlive.wordpress.com
i‘swhat i can do, so i do. don’t worry
about a thing it’s going to be okay…
www.pinterest.com/davejbuc3/american-heroes
social media does younger kids no good, ifn’ they do not have the wisdom to peer at images and not be affected, and do not avoid such stuff. our lives are so perfidious and this country’s morals are seriously out of wack, so agreeable to eyes that are continually seeking information. interest are a good attribute for kids and teens. this world we all live in is a wondrous; yet the advertising is… well, you figure it out. once an picture gets more than a glance it is in their malleable minds.
you know when stuff goes bad and falls all apart? you do not understand why this happened not that; like: you really want something for your birthday, or whatever, dudn’t matter… anyway, feel like you’d do anything to get that Christmas gift? and don’t find it under the tree that morning? you know what you call that? we call that life; get used to it. down here we suffer, we can look above; and aim in that direction; for that is where some will be; like forever, singing all the day long thanking Him for including us regular souls that at times are acting in a sinful nature. God knew that we will have those notions to act outside the will of God, yet that is the whole reason for His cross, Jesus Christ goes in our place to suffer the punishment we all deserve.
it’ll fill our minds, in the valley… get that SPRING of the valley.
https://wordpress.com/block-editor/post/the3rdonlive.wordpress.com/1095
it’s coming…
take that turn, my friend.
took disaster to have me on the good foot.
https://wordpress.com/block-editor/post/the3rdonlive.wordpress.com/1095
https://www.pinterest.com/davejbuc3
https://www.pinterest.com/davejbuc3/httpswordpresscomblock-editorpostcollactionalive15/
d’ya recall?
Suzi!
<!– /* Font Definitions */ @font-face {font-family:”ＭＳ 明朝”; mso-font-charset:78; mso-generic-font-family:auto; mso-font-pitch:variable; mso-font-signature:-536870145 1791491579 18 0 131231 0;} @font-face {font-family:”Cambria Math”; panose-1:2 4 5 3 5 4 6 3 2 4; mso-font-charset:0; mso-generic-font-family:auto; mso-font-pitch:variable; mso-font-signature:-536870145 1107305727 0 0 415 0;} @font-face {font-family:Cambria; panose-1:2 4 5 3 5 4 6 3 2 4; mso-font-charset:0; mso-generic-font-family:auto; mso-font-pitch:variable; mso-font-signature:-536870145 1073743103 0 0 415 0;} /* Style Definitions */ p.MsoNormal, li.MsoNormal, div.MsoNormal {mso-style-unhide:no; mso-style-qformat:yes; mso-style-parent:””; margin:0in; margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:12.0pt; font-family:Cambria; mso-ascii-font-family:Cambria; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:”ＭＳ 明朝”; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Cambria; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:”Times New Roman”; mso-bidi-theme-font:minor-bidi;} a:link, span.MsoHyperlink {mso-style-priority:99; color:blue; mso-themecolor:hyperlink; text-decoration:underline; text-underline:single;} a:visited, span.MsoHyperlinkFollowed {mso-style-noshow:yes; mso-style-priority:99; color:purple; mso-themecolor:followedhyperlink; text-decoration:underline; text-underline:single;} .MsoChpDefault {mso-style-type:export-only; mso-default-props:yes; font-family:Cambria; mso-ascii-font-family:Cambria; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:”ＭＳ 明朝”; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Cambria; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:”Times New Roman”; mso-bidi-theme-font:minor-bidi;} @page WordSection1 {size:8.5in 11.0in; margin:1.0in 1.25in 1.0in 1.25in; mso-header-margin:.5in; mso-footer-margin:.5in; mso-paper-source:0;} div.WordSection1 {page:WordSection1;} –>
16 For I am not ashamed of the gos-
pel of Christ, for it is the power of
God to everyone who believes, for
the Jew first and also for the Greek.
Ps 40:9, 10 – Acts 3:26
http://www.youtube.com/watch?v=ECiMhe4E0pI
http://www.last.fm/tag/davebucklexsforeyes
doubt that any of these cats are either
if they are, let me suggest they return.
\
such simple request belief. Hope none
are required to go through a situation
as was mine to get straight in the head
and decide which team to join. now the
choice on whether belief in OUR Savior
Jesus Christ is not a catch all decision, It
https://youtu.be/6Vl1m5FYlAo in the ear
is needed to come along with faith in Him.
https://youtu.be/8eGGSZUfEGA all through a
year that taste formation, of music, important
to this x-musician. About that, the taste is still
in me, but just not in a physical sense; no worry
the tastes are still solid as a rock, somebody at an
educated sight, musically speaking, are still those
purveyor of the radio station that, Kyle, Greg, Chip
heard discussed December, 1988, @ first lunch in a
TX training camp named Brazoswood High in a NOT
too deep heart of Texas, enjoy, possibly:
https://www.last.fm/user/daverave38/library/artists
from Maynard Ferguson, Herb Alpert,
https://youtu.be/8eGGSZUfEGA 
https://youtu.be/0Ws-J8_8VxQ 
https://youtu.be/6Vl1m5FYlAo 
https://biblehub.com/kjv 
https://youtu.be/tHVe03MhDpI 
https://youtu.be/yHV04eSGzAA 
https://youtu.be/It7107ELQvY 
https://youtu.be/8AHCfZTRGiI 
https://youtu.be/vltC-O7PDYQ 
http://www.youtube.com/watch?v=tSsiS-v6_6M 
https://iblp.org/questions/what-should-we-do-when-we-face-tests-and-trials 
https://www.youtube.com/watch?v=wG0fS4DoGUc 
https://youtu.be/bzxWhUv8dyg 
https://youtu.be/Rp-kT3Pl3tw 
https://youtu.be/hi53rgdJyvI 
https://youtu.be/-L41MhFPU9s 
http://www.youtube.com/watch?v=C7wexi6F5zM
David 2 subscribers
555 Comments
https://www.pinterest.com/davejbuc3/httpscollactionafileswordpresscom2019070-5jpg/M
council of God’s Word again.
the3rdonlive.wordpress.com/2019/09/18/mr-mellow
peace, a relative term; what is named peace is all our own, a very personal belief. air’ a super creation for us. as is the air that gives all the ability to exist. smoking messes with that gift from God. think about it. it is not only your lungs messed up; you are marring your cilium…
it is, for all intrinsic purposes: The American Indian revenge.
for us stealing THEIR God given lands; to do so much more that it scars, burns, floods God’s home He created for us. smoking breeders cancer coating the villa that changes the air sucked into those superlative organs named lung; why would you want to go all graffiti like upon the engine that is responsible for converting the breeze we create; the one traveling inside the muscular tube that delivers, convey food from that mouth to the stomach and such in humans.
about nine inches (about 23 centimeters) long; passing from the pharynx, down the trachea in front of the spinal column and behind left bronchus where it pierces the diaphragm; slightly to the left of the middle line, and finally: supplies oxygen rich blood to the cardiac organ.
don’t mess with a mechanism we have no business bugging. muscular tube to convey food from the mouth to the stomach and that in humans.
BLOOD: the fluid that houses the soul.
the blood that fuels the machine of ours.
More on WordPress.com
And now for something completely different: Dr. Larry Dixon; The Forgotten Third: Developing a Relationship with God and our Holy Spirit; He illuminates, to believers dwells in us.
it being overemphasized?
overlooked? Is the question regarding our God? Our Holy we need to answer?
Art Chartier, The Peanut Gallery Saturday Morning, 06 Jul 2019 1 Peter 1:13-25; be Holy in all you do; in the Name of the Father, and of the Son, in our Holy Spirit. Amen. https://youtu.be/gdMo6QTnHrM
ARDMORE
https://www.youtube.com/watch?v=5IsSpAOD6K8
https://youtu.be/FHhZPp08s74
https://youtu.be/7B92VAqP2dw
https://www.pinterest.com/davejbuc3
https://www.pinterest.com/davejbuc3/httpscollactionafileswordpresscom2019070-5jpg/M
https://the3rdonlive.wordpress.com/2019/09/18/801/
https://youtu.be/1vrEljMfXYo
master of chosen instrument
dig Maynard, Herb, Leess
https://youtu.be/Kzf7FJ3GabY
https://youtu.be/NC38-qqiVgg
https://youtu.be/iSJKUXzv7HY
agree?
Preview YouTube video Maynard Ferguson “Stay Loose With Bruce”
https://www.yelp.com/biz/ardmore-barbershop-winston-salem
Preview YouTube video Herb Alpert & the Tijuana Brass A Taste of Honey
https://the3rdonlive.wordpress.com just slip out the back, Jack drop off the key, Lee.
Preview YouTube video Primus – Videoplasty – 05 – “Tommy the Cat” (re-edited)
https://the3rdonlive.wordpress.com/2019/09/18/801/
https://youtu.be/IQzQ_71-G8w
https://www.truthortradition.com/articles/revelation-what-it-is-and-how-it-is-received
https://youtu.be/OqYYp5cTuM8
https://www.youtube.com/watch?v=8rlDTK6QI-w&feature=youtu.be
https://youtu.be/9ApKBKSL1Jc
https://youtu.be/ut7GU_L7Jmo
http://www.reddit.com/r/LetsTalkMusic/comments/a2l7lt/hot_take_tina_weymouth_is_one_of_the_greatest
https://youtu.be/ECiMhe4E0pI
https://youtu.be/Gs069dndIYk
https://youtu.be/uq-gYOrU8bA
https://youtu.be/ABXtWqmArUU
https://youtu.be/8rlDTK6QI-w
https://the3rdonlive.wordpress.com/2019/09/18/801
https://youtu.be/hvW9PVhUsfE
https://youtu.be/6sIjSNTS7Fs
https://youtu.be/e9yK1QndJSM
https://youtu.be/cqKXEZJV2YU
https://wordpress.com/view/the3rdonlive.wordpress.com
https://youtu.be/ICknQrUmZWA
https://youtu.be/qQzdAsjWGPg
https://youtu.be/rDyb_alTkMQ
https://youtu.be/MHEwCagBtN0
https://youtu.be/v9JOsxnFx-I
Peter Gibbons hates his job and the obnoxious Division VP Bill Lumbergh who has just hired two efficiency consultants to downsize the company. His best friends are two software engineers Michael Bolton and Samir Nagheenanajar, that also hate Initech, and his intrusive next door neighbor Lawrence. He believes his girlfriend Anne is cheating on him but she convinces Peter to visit the hypnotherapist Dr. Swanson. Peter tells how miserable his life is and Dr. Swanson hypnotizes him and he goes into a state of ecstasy. However, Dr. Swanson dies immediately after giving the hypnotic suggestion to Peter. Peter, in his new state, starts to date the waitress Joanna and changes his attitude which results in his being promoted by the consultants. When he discovers that Michael and Samir will be downsized, they decide to plant a virus in the banking system to embezzle fraction of cents on each financial operation into Peter’s account. However Michael commits a …
Written by –
Claudio Carvalho, Rio de Janeiro, Brazil
THIS ‘s super description
of His love for us, (U.S.: the
nation devised among those
principals of Christianity.) dig
yup, the country, this country’s
‘This Country, under God;’ see it
right there in OUR national song.
music; the voice of Angels; so true
https://www.intouch.org/Watch/Sermon-Series/life-principles-to-live-by/gods-pathway-of-brokenness-video
https://www.pinterest.com/davejbuc3
https://www.intouch.org/Watch/Sermon-Series/life-principles-to-live-by/gods-pathway-of-brokenness-video
Mr. Mellow
thank you, happiness engineer
https://youtu.be/yfsmmk93H3I –
https://www.pinterest.com/davejbuc3/tried/
you know what ‘m talkin’ about.
https://www.youtube.com/watch?v=akDCUPUgBiQ
https://biblia.com/bible/esv/Dan%203.17
You are doing so. This is the way. The way of
uncertain future and faltering steps. It is My Way …
The time has come, when be wise for what you do in the months ahead. Pay Attention.
the3rdonlive.wordpress.com
www.wfaa.com/article/news/local/texas-am-student-from-frisco-in-critical-condition-after-hit-and-run-accident/287-866dc82a-7048-486d-8f69-0fbc49d15f4c
https://the3rdonlive.wordpress.com/2019/09/17/thank-you-happiness-engineer
https://www.youtube.com/watch?v=GUyjymEYnsg
Scriptures to study for understanding the truth about the end time “catching away” in context: Matthew 24:24-44 1 Thessalonians 4:13-18 and 5:1-11 2 Thessalonians 2:1-12 Mark 13:27 1 Corinthians 15:51 Luke 21:25-28
choose
Who am i going to follow? God? you will never lose with God.
it’s not about me, it’s not about any of the fun nowadays; it’s about Him.
if you are willing to choose, you reap what you sow, you cannot be surrendered to Him beyond, you want God’s best? and are you can be forgiven – He will take you where you are, watch Him work. a forgiveness that Jesus provides all is as active for you as it is for me, and you, and them, and them; even them, them.
https://www.pinterest.com/davejbuc3/be-secure-in-life-know-there-is-more-than-meets-th/and-how/
https://www.biblegateway.com/quicksearch/?quicksearch=Daniel+&qs_version=KJV
https://www.youtube.com/user/pizzahut/videos
https://www.youtube.com/watch?v=EE7TJNm5YAY
https://the3rdonlive.wordpress.com/2019/09/18/mr-mellow/
book
book
If you want 9/7/19 10:00PM
reflect what is true – https://collactiona.live
shine as He does
If you want to work and they want to play, stay away.
If you want good and they want bad, stay away. If you
want a better life you; never find it by being with negative
people. Be the you that you want to be, not you that they
are. I know the friends do dope, but I do not. See the kids over
there stay away; they are dopers. I know my friends are all failing
in school, I make good grades. Those kids over there…… stay away
they are losers. It may not be fair; people are very quick to judge, that
is the world we live in. Want to be a success, hang out with smart people.
Want to have great relationship, hang out with those that have one… if you
want a better job, be with ones that have one, may be able to help you get one.
https://wordpress.com/block-editor/post/collactiona.live/1485
https://the3rdonlive.wordpress.com/2019/09/30/hear-ye-hear-ye/
https://www.pinterest.com/davejbuc3
https://wordpress.com/block-editor/post/collactiona.live/1485
https://wordpress.com/block-editor/post/collactiona.live/1485 
here you go.
listen
www.youtube.com/watch?v=j1a8FsHTD4U https://youtu.be/tnjL2cx4AUc
https://wordpress.com/block-editor/post/the3rdonlive.wordpress.com/513
https://youtu.be/q6que2GTblE
https://collactiona.live/2019/07/07/https-collactiona-live-2019-08-12-jesus-makes-a-way/#jp-carousel-1223
https://the3rdonlive.wordpress.com/author/davidb48
was all over ten two 1992
this afternoon, do smile
This statement cements hope
Our Lord, we know that Thou art great and able to deliver us.
I Am your deliverer. Trust in Me absolutely. Know that I will
do the very best for you. Do be ready, and willing for My Will
to be done.
Know that with Me all things are possible. Cling joyfully to that truth.
Say many times, “All things are possible with My Master, My Lord, My Friend.”
This truth, accepted and firmly believed in, is the ladder up which a
soul can climb from the lowest of pits to the elevated of heights.
If it be so, our God whom we serve; is able to deliver us from
the burning fiery furnace, He will deliver us out of thine hand, O king. Daniel 3:17
…………………………………………………………………………………………………………………………………………
August 13 – Perfection https://youtu.be/o9gK2fOq4MY?t=7 O Jesus, help us, we beseech Thee. www.youtube.com/watch?v=M_Q6ZSzV8iQ Ever your Helper through dark to Light, through weakness to Power, through sin to Salvation, through danger to Security, through poverty to Plenty, through indifference to Love, through resentment to Perfect Forgiveness. https://www.youtube.com/watch?v=6SJtqLhlELA Never be satisfied with a comparison with those around you. Ever let My words ring out. “Be ye therefore perfect even as your Father which is in Heaven is perfect.” Stop short at nothing less. https://www.youtube.com/watch?v=dOu2NpXXgiI Make it your practice, each of you, to review your character — take it in relation to life, to your dear ones, your household, friends, acquaintances, your country, your work; created with an intention to create a blog, www.christianheadlines.com/contributors/michael-foust/skillets-john-cooper-willing-to-defend-christ-if-it-costs-me-my-career.html See where I, in the same relation or circumstances or situation, should act differently. Plan how best such and such a fault can be eradicated, or such and such sin, mistake, or omission, be avoided. my weekly review – https://collactiona.live/2019/07/06/www-thankyoujesussign-org/#comment-236- at least you must have. Follow peace with all men, and holiness, without which no man shall see the Lord. Looking diligently lest any man fail of the grace of God. Hebrews 12:14,15 when we fully surrendered to the Lord Jesus it begins. WHEN YOU DO? IT WILL NOT BE TOO RECOGNIZABLE, cause: IT’S LIFE; REAL LIFE, AT IT’S BEST, BEGINS FOR YOU! be serious about your future, https://dailyencouragement.wordpress.com https://collactiona.live/2019/07/06/https-the3rdone-live-2/comment-page-1/#comment-236 www.youtube.com/watch?v=QyUpLap-VuU
The Blessing of Brokenness by Carter Conlon https://www.youtube.com/thelifeofjesus Go forward unafraid. Face each difficulty, however great and seemingly unconquerable, as you go forward towards it. The strength you will require from Me for that adventure into danger, as it may seem to you, will fortify you for its overcoming. “Fear thou not to, for I AM with thee, Be not afraid for I am thy God. I will strengthen thee, I will help thee, Yea, I will uphold thee with the right arm of My Righteousness.” “must be in the plan.” be willing to break. everyone needs breaking; as if that’s a panacea for day to day strife.God has a pathway: brokenness. www.youtube.com/watch?v=0kpJp2W6i9Y Consider Yourself Dead if Christ was willing to die for you, if you are not willing to perish, for Him, you’ve long road to travel before death. When we receive Jesus as our Savior, we no longer need to focus on our sin. Instead, we become dead to sin and receive grace to live in His righteousness. 5 min ago Go forward unafraid. Face each difficulty, however great and seemingly unconquerable, as you go forward towards it. The strength you will require from Me for that adventure into danger, as it may seem to you, will fortify you for its overcoming. “Fear thou not to, for I AM with thee, Be not afraid for I am thy God. I will strengthen thee, I will help thee, Yea, I will uphold thee with the right arm of My Righteousness.” ” MUST BE IN THE PLAN.”come see. be willing to break. everyone needs breaking; as if that’s a panacea for day to day strife.God has a pathway: brokenness. http://www.youtube.com/watch?v=0kpJp2W6i9Y ” So you also must consider yourselves dead to sin and alive to God in Christ Jesus.” Romans 6:11 Consider yourself dead. That’s a pretty striking statement. We love to talk about being “alive” in Christ. So why do I see so many Christians trudging through life powerless, purposeless, and lost in their pursuit of Jesus? great culling away those who just do not get it… hope you aren’t one such individual. what’s the scene for those prepared? in the words of a great man: “I don’t know…” neither do i, yet the sadder comparison speaks for itself: Heaven or Hell; why would you get lazy when you understand what it’s like in either one? choices, hope everyone makes a wiser decision. He desires all people to be saved in His kingdom; away from those blistering years for those who did not know Jesus while they were/are on terra firma; those who did not know Jesus while they were down here. may God bless your soul… View Post https://collactiona.live/?p=1388 Faith https://www.pinterest.com/pin/322500023303840342/?lp=true And we have known and believed the love that God hath to us.God is love; and he that dwelleth in love dwelleth in God, and God in him. John 4:16 Lord, bless us and this evening hour, and in Thy Mercy heal us all. Do not think that suffering is the only path into My Kingdom. There are sunlit glades, and ways amid the loveliest flowers, along which the steps and hearts of men are drawn to Me. There are birds and laughter and butterflies, and warm, life-giving summer air, and with these as tender companions and friends, the Joy-Way into the Kingdom can be taken. Bleak, cold, and desolate, brier-beset and stony, are not all the ways. Leave all to Me. The choice of ways, the guidance in the Way. But when the sunlight calls accept it gladly. Even in the Spirit-World appreciation results from contrary experience. Can the fireside of home be more dear than to the traveler who has forced his way over bleak moor and through blinding storm? Take to your hearts this word of cheer. “He will not suffer you to be tempted above that ye are able but will, with the temptation, also find a way of escape that ye may be able to bear it.” The world is not the Kingdom. In the world ye shall have tribulation but “be of good cheer, I have overcome the world.”
Live with Me, the Conquering Christ, and the Joy and Peace of conquest shall be yours too. https://wordpress.com/view/the3rdonlive.wordpress.com
https://www.youtube.com/watch?v=yqw9zlK-un0
……………………………………………………………………………………………………………………………………..….
weakness to Power,
sin to Salvation,
danger to Security,
https://www.pinterest.com/davejbuc3/truth-as-we-age-it-becomes-clearer/
through indifference to Love
Life, earth-life, is a battle.
The battle in which man will always be the .
UNLESS he summons Eternal Life-Forces to his aid.
Do this and all that has the power to thwart you slinks back defeated.
through poverty to Plenty,
Say, in the little as well as the big things of life,
“Nothing can harm,
nothing can make me afraid.
In Him I conquer.” Stand invincible, face the foes of life.
https://www.youtube.com/watch?v=vXqbTZZYNak
if you only believe. anything is possible for those who believe.
Many are wondering why their desire for righteousness
is not satisfied according to My Promise. But that Promise
was on condition that there should be hunger and thirst. If the
Truths I have given have not been absorbed, there can be no real
hunger for more.
So, when you miss the Joy-Light on your path, when the vision seems lost,
and the Voice silent, then ask yourself, have you failed to live out the lessons
that you were taught?
Live out My teaching in your lives, and then, hunger for more, come to Me, Bread of
Life, Food of your souls.
https://youtu.be/OLPiObt0lxA re-posting is not too genuine; but helps me spread speeches that have helped me in a pronounced way each of us, in-spite all the unwholesome actions, whether it’s spoken or acted out; we are all forgiven providing the repentance’s felt and verbalized to His gracious forgiveness. we may forbear our manifold actions. and show our robes as white, as driven snow. we should place a greeting on our souls front door, yes, us. learning the depth of forgiveness is not license to continue disregard Him in each thought word and deed; no rather a boost to our good minded intent see the light: our activity.
bless you.
https://collactiona.live/2019/09/19/septe3mber-19-151-2pm-ad
God can do anything
God Can Do Anything
The Collingsworth Family
God can do anything with anything
He can heal any hurt, any suffering
Every cross, every care, every burden He bare For anyone, anywhere
God can do anything
He turns nothing into something
He‘s the giver of life
He‘s hope to the hopeless
And a sight to the blind
And He makes impossible, possible
When there’s no other way
He makes the blackest sin,
white as snow.
That’s why we can say
God can do anything with anything
He can heal any hurt, any suffering
Every cross, every care, every burden He bare
For anyone, anywhere
God can do anything
The fairest of ten thousand
my soon coming King
Jehovah, Messiah reason why I sing
He’s Alpha and Omega
The Beginning and the End
My Savior and Redeemer
He‘s my closest friend
God can do anything with anything
He can… [AND WILL]
| Dear WP, |
| It’s good to know that we can give everything to Jesus. We often think about giving Him our worries, our requests. But do we think about giving Him what we’re lacking as well? David Buckle, do you ever get up in the morning and just not want [no… not really… the sun came out today, going for a walk, get some coffee .o. to… Give Smile, do good. There’s good news: Jesus can take this lack, this nothingness, this empty space, and fill it with His fullness! If this is the case for you today? Pray this prayer with me… “Lord, this morning, I feel empty, as if I have nothing to give. I want to love people, but I need You to do it through me. Fill me, Lord, with Your love, Your presence, Your joy, and Your enthusiasm. Thank You, I know that You’re doing it even now! I believe Your Word “of [Your] fullness we have all received, grace for grace.” (John 1:16 (KJV) I have Your fullness! I love You, Lord. Amen!” Thanks for existing! |
https://collactiona.live/2019/09/28/auto-draft-2
https://www.pinterest.com/davejbuc3/american-heroes/usmc
wordpress.com/collactiona.live
Viewing: collactiona.live
Analytics overview
New
Filters
7/20/2019 — 8/18/2019
Organic?
Paid and earned
Claimed accounts?
All Pins?
youtube?www.youtube.com/channel/UCVW-2rLA1wXXr32fmeF3bHg
Impressions not tryin’ to impress…
68.7k
85%
Total Audience neat o
43.86k
95%
Engagements WHAT? we never…
4.87k
276%
Engaged Audience whose the engaging?
4.16k
348%
Compared to previous 30 days
youtube.com/channel/UCVW-2rLA1wXXr32fmeF3bHg
Viewing: collactiona.live
7/20/2019 — 8/18/2019
Organic?
Paid and earned
Claimed accounts?
All Pins?
youtube?
Impressions not try to impress…
68.7k
85%
Total Audience neat o
43.86k
95%
Engagements WHAT? we never…
4.87k
276%
Engaged Audience whose the engager?
4.16k
348%
Compared to previous 30 days
HI!
8/6/2019 9:17.33
| BE FILLED WITH THE SPIRIT THAT LOVES wordpress.com/block-editor/post/collactiona.live/1354 |
| And be not drunk with wine, wherein is excess;but be filled with the Spirit. Ephesians 5:18 Rest more with Me. If I, the Son of God, needed those times of quiet communion with My Father, away, alone, from noise, from activity, each of you then surely you need them too. Refilling with the Spirit is a need. That dwelling apart, that shutting yourself away in that secret place of your being; away alone with Me. From these times you come forth in Power to bless and heal, to Cease Rest more with Me. If I, the Son of God, needed those times of quiet with My Father, away, alone, from noise, from activity; the surely you need them too. Refilling with the Spirit is a need. That dwelling apart, in shutting yourself away in the very secret place of your being away alone with Me. From these times you come forth in Power to bless and heal. |
First the bad news
Because of sin, we are born separated from God. Without intervention, we are NOT eligible for Heaven. This applies to the entire human race.
You are not alone.
www.kingjamesbibleonline.org/Romans-3-23 says,
“For all have sinned, and come short of the glory of God;”
Romans 3:10 says, www.kingjamesbibleonline.org/Romans-3-10
“As it is written, There is none righteous, no, not one:”
Romans 6:23, www.kingjamesbibleonline.org/Romans-6-23
“For the wages of sin is death;”
Revelation 21:8, http://www.biblegateway.com/passage/?search=Revelation+21%3A8&version=KJV
“But the fearful, and unbelieving, and the abominable, and murderers, and whoremongers, and sorcerers, and idolaters, and all liars, shall have their part in the lake which burneth with fire and brimstone:”
There is no amount of good works we can do to save ourselves from being eternally separated from God.
Ephesians 2:8-9, http://www.bible.com/bible/1/EPH.2.8-9.KJV
“For by grace are ye saved through faith; and that not of yourselves: it is the gift of God: Not of works, lest any man should boast.”
To be separated from God forever, simply do nothing. To ignore or reject God’s son is the only sin that can keep a person out of Heaven and the only alternative to Heaven is eternal torment in the Lake of Fire (Revelation 20:15, 2 Thes. 1:7-9).
John 3:18, http://www.kingjamesbibleonline.org/John-3-18
“He that believeth on Him is not condemned: but he that believes not is condemned already, because he hath not believed in the name OF the only begotten Son of God.” https://www.youtube.com/thelifeofjesus
But there is good news!
There is a simple and free way to be reconciled with God made possible by God’s only son Jesus. A blood sacrifice was needed to pay for your sins and Jesus was sent to become that sacrifice. He was nailed to a Roman cross to shed His blood in payment for your sin. Then three days after His death, He rose from the dead, validating once and for all His qualification to be our only Savior.
Placing your complete trust in Jesus’ death, burial and resurrection is God’s one and only means of reaching Heaven.
Jesus Christ said John 14:6, www.kingjamesbibleonline.org/John-14-6
“I am the Way, the Truth, and the Life: no man cometh unto the Father, but by Me.”
John 3:16 & 17, www.biblegateway.com/passage/?search=John+3%3A16-17
“For God so loved the world, that he gave his only begotten Son, that whosoever believeth in Him should not perish, but have everlasting life. For God sent not his Son into the world to condemn the world; but that the world through him might be saved.”
The Bible clearly tells us how to be saved:
Romans 10:9-10, www.biblegateway.com/passage/?search=Romans+10%3A9-10Romans 10:9-10
“That if thou shalt confess with thy mouth the Lord Jesus, and shalt believe in thine heart that God hath raised him from the dead, thou shalt be saved. For with the heart man believes unto righteousness; and with the mouth confession is made unto salvation.”
This is a free gift from God because He loves you.
Romans 6:23, www.biblegateway.com/passage/?search=Romans+6%3A23
“but the gift of God is eternal life through Jesus Christ our Lord.”
Romans 10:13, http://www.kingjamesbibleonline.org/Romans-10-13
“Whosoever shall call upon the name of the Lord shall be saved.”
Are you ready to believe right now? If so, simply tell God what he
asked you to confess. You might use a prayer similar to this one:
“God, I admit to you that I am a sinner, and I know I cannot do
anything to earn my way to Heaven. I truly believe that Jesus
died on the cross, was buried and rose from the grave. I put
my faith in His sacrifice to pay for my sin in full.”
http://www.the3rdonlive.wordpress.com
How might YOU choose?
www.cru.org/us/en/train-and-grow/spiritual-growth/core-christian-beliefs/heaven-and-hell.html definition; however long-winded, the best one.
What does Jesus pray when He intercedes for us? This is important to know, because in finding the answer to that question we can discover God’s plan and purpose for us. And that is the objective of prayer: to align our wills with the will of God.
In John 17 we have the greatest prayer ever prayed, which is Jesus’ prayer for us. In verse 11 Jesus prayed, “Now I am no longer in the world, but these are in the world, and I come to You. Holy Father, keep through Your name those whom You have given Me, that they may be one as We are.”
Jesus prayed for our preservation. God wants us to be strong spiritually. God want us to cross the finish line with flying colors. We all know people who have made a profession of faith and were growing so much spiritually that we may have even looked up to them as spiritual leaders. But then one day they crashed and burned. They simply walked away from the faith.
We may think,
“If someone like that fall, then maybe I could fall, too. Am I next?”
The answer to that question may surprise you:
‘it is entirely up to you.’
God does, always want to keep you, and God will keep you.
He will keep you to the end. The question is whether you want to be kept.
first few days of Oct., 1992, dave was saved.
https://www.youtube.com/watch?v=wXwGh3bdF5k
https://youtu.be/3Nqg36t0Pgg
https://youtu.be/bFmRY7-D6vY
https://youtu.be/FwWPL8iPB64
https://youtu.be/26_ABZSG28U
https://youtu.be/sREXLl3FiV
https://youtu.be/uyNPV3hIOGI
https://youtu.be/4fKixmVPcR8
https://youtu.be/4fKixmVPcR8
https://youtu.be/r-9L2-aVR4I
https://youtu.be/fEUyClYg0sk
https://youtu.be/cYurafmTwcw
https://youtu.be/BDUnfcuqfIA
https://youtu.be/LXL49kBROH8
https://youtu.be/KAhdu66PJjc
https://i.pinimg.com/originals/f5/a2/65/f5a26585cf9d8ae39ac4347432d4be0c.jpg
https://the3rdonlive.wordpress.com/2019/09/21/fiat/
“The Deceitfulness Of Sin”
“Sin will take you farther than you want to go,
keep you longer than you want to stay,
and cost you more than you want to pay”
Attributed to Ravi Zaccharias
Listen to our message
“But encourage one another day after day, as long as it is still called ‘Today’, so that none of you will be hardened by the deceitfulness of sin” (Hebrews 3:13).
Last Friday we shared a message titled “A Lesson From Yeast” a teaching that even a little bit of something (like yeast) can result in a lot of good or a lot of bad. The progression of a little matter becoming bigger and bigger and more and more destructive is a consequence of “the deceitfulness of sin”.
We have seen many illustrations of this in our ministry. People dabble and then dabble more, than they are caught in sin’s trap. We are always sensitive regarding confidentiality but an older recollection comes to mind going back some 15 years. I was in a small prayer group and one of the members seemed to have an earnest walk with the Lord. However he became involved with another woman who was not his wife and just crashed. Now admittedly I don’t know the specifics but likely it was a progression of bad choices that lead to his fall. His heart was hardened by the deceitfulness of sin.
The writer of Hebrews gives us a command we can all seek to obey. It’s a command for all, not a specific spiritual gift for a few. It also makes a tidy three point message:
What are we to do? “Encourage one another.” We tend to limit the meaning of the word, “encourage” in the English to be an uplifting, positive message. However the underlying Greek word Parakaleo, while certainly including this sense, has further depth and is translated in some versions “exhort”.
Biblical encouragement is an exhortation to live faithfully for the truth. An online resource states, “Parakaleo can include the idea of giving help or aid but the primary sense in the New Testament is to urge someone to take some action, especially some ethical course of action. Sometimes the word conveys the idea of comfort, sometimes of exhortation but always at the root there is the idea of enabling a person to meet some difficult situation with confidence and with gallantry.” *
When are we to do it? “Day after day, as long as it is still called ‘Today’“. I have always thought the writer might be employing some humor here demonstrating the ongoing need to encourage, after all, each current day will always be called “Today”! This verse along with Hebrews 10:23-25 is the basis of our ministry’s name “Daily Encouragement”
Why are we to do it? “So that none of you will be hardened by the deceitfulness of sin“both the encourager and the one being encouraged, similar to the Proverb that states, “Whoever refreshes others will be refreshed” (Proverbs 11:25). We must always be on our guard lest we develop a hardened heart toward spiritual truth and obedience due to the deceitfulness of sin.
The deceitfulness of sin is rampant in our world and has been ever since Satan deceived Adam and Eve in the garden. But we believe the many means of being deceived by sin is increasing, especially due to technology. May God help each of us to boldly stand firm while contending earnestly for the faith once for all delivered to the saints. We urge, exhort, and warn you to be on your guard against the heart-hardening effect of sin’s deceitfulness.
Be encouraged today,
Stephen & Brooksyne Weber
Praying manDaily prayer: Father, as believers, we are put to the test daily regarding our adherence to the Scriptures that teach right from wrong, truth from error. The Bible includes numerous examples of those who were obedient to Your laws and from those who chose to disregard them. Help us to remember that disobedience, disregard, or dilution of the Scriptures will weaken us and eventually harden our hearts to spiritual truths. We choose either to be shaped by the world or by the Word. Our will and desires cannot be shaped by both. We choose this day to be Your obedient servant no matter the consequences, for Your blessing is more to be desired than the applause of the world. Amen.
Today’s Suggested Music and Supplemental Resources
“Yes I Will” Video Vertical Worship Great song posted w