

https://www.youtube.com/watch?v=m6kB16LWr88 Y A W E H
collactiona.live B E . F E A R L E S S D O Y O U . H A V E H O P E
argue? God forbid…
.+ r a d i o ++.
. s e e k . f i r s t .

I The Lord God, I change not, My holiness. You will be judged.


any publishers interested?

maybe the internet?
Relax, do not get tense, have no fear. All is for the best. How can you fear change when your life is hid with Me in God, who changeth not – and I Am the same yesterday, today, and forever. You must learn poise, soul-balance and poise, in a vacillating, changing world.
Alex Scourby
Carolina Theatre


Christ IS THE ANSWER; still

“Say not ye, There are yet four months, and then comes harvest? behold, I say unto you, Lift up your eyes, and look on the fields; for they are white already to harvest.”
John 4:35
When you think of those of whom you read who are in anguish, do you ever think how My Heart must ache with the woe of it, with the anguish of it? If I beheld the city and wept over it, how much more should I weep over the agony of these troubled hearts, over lives that seek to live without My sustaining Power.

“They will not come into Me that they might have Life.” Live to bring others to Me, the only Source of Happiness and Heart-Peace.


be like yourself

hey there



Collection by David Buckle

My Consolation Oh Jesus, come and walk with us and let us feel Thy very nearness. I walk with you. Oh! think, My children, not only to guide and comfort you and strengthen and uphold, but for solace and comfort for Myself. When a loving child is by you, is the nearness only that you may provide protection and help for that little one? Rather, too, that in that little child you may find joy and cheer and comfort in its simplicity, its Love, its trust. So, too, is it in your power to comfort and bring joy to My Heart. And I will walk among you, and will be your God, and ye shall be My people. personal safety ( He is in control )

Long_Layered_Bob_Hairstyle_2011_6.jpg 700×826 pixels Choppy Bob With Bangs, Heavy Bangs, Short Hair With Bangs, Haircuts With Bangs, Bob Haircuts, Blunt Bangs, Blunt Fringe, Long Face Haircuts, Short Choppy Bobs

Choppy Bob With Bangs

Heavy Bangs

Short Hair With Bangs

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

now 'm thinkin' dirty stuff...  JK!

David Buckle

……………… disqus.com/by/dave_buckle

Soul Surfer: The Bethany Hamilton Story -- Inspiring People, Books and Films Bethany Hamilton, Surf Mar, Soul Surfer, Surf Girls, Beach Girls, Christian Inspiration, Surfs Up, Surfing, Good People

Soul Surfer Bethany Hamilton: Inspirational Christian Athlete

Bethany Hamilton Surf Mar Soul Surfer Surf Girls Beach Girls Christian Inspiration Surfs Up Surfing Good People

Soul Surfer: The Bethany Hamilton Story – Inspiring People, despite that she did return to competing.


Veteran’s memes to remember (43 Photos)

Good PeopleAmazing People

So SadSad LoveSweet StoriesCute Stories Beautiful Stories


Graffiti Art


Vietnam WarHistory FactsWorld HistoryHistory WeirdFunny HistoryHistory QuotesHistory TimelineInteresting HistoryInteresting Facts

The Price Of Freedom Remember, when You look out on a Garden of Stone, You see the REAL Cost of War. Something to Remember today, 19 May Armed Forces Day

Army Retro Print – Army Proud – Retirement Gift – Army Wife – Father’s Day – Veteran Gift – Love My Soldier – Boot Camp Graduation Gift

Sad StoriesTouching StoriesAngel StoriesI Look To YouAll I Ever WantedMilitary LoveMilitary MemesSincerityGod Bless America

I’m crying. This is how our Marines honor each other with respect. How does the president honor them.cutting or stopping their pay. >>> I can’t stop crying

Jesus is all.

David Buckle


"Jesus Is My Savior!!!!!" by johnnawood ❤ liked on Polyvore featuring interior, interiors, interior design, home, home decor and interior decorating Love The Lord, God Is Good, Gods Love, I Love Him, Lord And Savior, God Jesus, God Loves Me, Jesus Loves Me, Faith In Humanity

Jesus Is My Savior!!!!!

Love The LordGod Is GoodGods LoveI Love HimLord And SaviorGod JesusGod Loves MeJesus Loves MeFaith In Humanity

“Jesus Is My Savior!!!!!” by johnnawood ❤ liked on Polyvore featuring interior, interiors, interior design, home, home decor and interior decoratingDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Do not mess with The Ghost. Military Humor, Military History, Military Tactics, Military Love, Us History, History Facts, American History, American War, Real Hero

25 Soldiers With Killing Sprees Straight Out Of Call Of Duty

Military HumorMilitary HistoryMilitary TacticsMilitary LoveUs HistoryHistory FactsAmerican HistoryAmerican WarReal Hero

Do not mess with The Ghost.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Julia Meikle Ben-Nyah's photo. Bible Scriptures, Christian Living, Christian Life, Christian Quotes, Word Of God, Faith Quotes, Bible Quotes, Battle Ground, Prayer Warrior

Bible ScripturesChristian LivingChristian LifeChristian QuotesWord Of GodFaith QuotesBible QuotesBattle GroundPrayer Warrior

Got nothing you can’t get me with anything – PVC Out in the world is on his terms, here at home is on mine – survive if you can satun. quotes for her

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Hey look!, these small boys know how to salute the troops. But our so called President doesn't. Soldado Universal, Faith In Humanity, We Are The World, Fight For Us, Military Love, Military Salute, Real Hero, American Soldiers, Toy Soldiers

Soldado UniversalFaith In HumanityWe Are The WorldFight For UsMilitary LoveMilitary SaluteReal HeroAmerican SoldiersToy Soldiers

Salute – respect for our military-our troops

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

We're up here at the vacation home in the pines for a long weekend with four dogs (yea, we brought … Ak47, Out Of Touch, Guns And Ammo, Pro Gun, Liberal Logic, Gun Rights, 2nd Amendment, So True, Firearms

Sunday Brickbats, Odds, Ends, And One Funny Thing

Ak47Out Of TouchGuns And AmmoPro GunLiberal LogicGun Rights2nd AmendmentSo TrueFirearms

We’re up here at the vacation home in the pines for a long weekend with four dogs (yea, we brought …David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Do you have a military hero in your family? Search Ancestry records to discover family draft cards, passenger lists, and more. Discover more today. Genealogy Research, Family Genealogy, Genealogy Websites, Ancestry Records, Military Records, Family Matters, Free Family Tree, Family Search, Record Collection

U.S. Military Records Collection

Genealogy ResearchFamily GenealogyGenealogy WebsitesAncestry RecordsMilitary RecordsFamily MattersFree Family TreeFamily SearchRecord Collection

Do you have a military hero in your family? Search Ancestry records to discover family draft cards, passenger lists, and more. Discover more today.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

The Man Who Held Off Six Enemy Tanks and Several Waves of Infantry for an Hour By Firing on Them While Standing Atop a Burning Tank Real Hero, Before Us, Us Army, Armed Forces, Military History, Military Photos, World War Two, World History, Wwii

The Man Who Held Off Six Enemy Tanks and Several Waves of Infantry for an Hour By Firing on Them While Standing Atop a Burning Tank

Real HeroBefore UsUs ArmyArmed ForcesMilitary HistoryMilitary PhotosWorld War TwoWorld HistoryWwii

Audie Murphy received every U. decoration for valor available to Army ground personnel at the time. He earned the Silver Star twice in three days, two Bronze Star Medals, three Purple Hearts, the Distinguished Service Cross, and the Medal of Honor.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

This is a legitimate post from a Christian Facebook page.... Gods Not Dead, Ewan Mcgregor, God Loves Me, Jesus Loves Me, Lord And Savior, God Jesus, Jesus Christ, Christian Memes, Christian Facebook

This is a legitimate post from a Christian Facebook page….

Gods Not DeadEwan McgregorGod Loves MeJesus Loves MeLord And SaviorGod JesusJesus ChristChristian MemesChristian Facebook

Our Lord and savior obi wan kanobiDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Fuck Yeah! #VeteransDay #VeteransThankYou #VeteransHonoring #VeteransAppreciation  #VeteransSupport #VeteransWomen #VeteransHomeless #VeteransArmy #VeteransMilitary #VeteransNavy #VeteransHusband #VeteransRespect Royal Marines, Army Humor, Military Humor, Military Life, Military Art, Military Style, Marine Corps, Military Careers, Military Quotes

Royal MarinesArmy HumorMilitary HumorMilitary LifeMilitary ArtMilitary StyleMarine CorpsMilitary CareersMilitary Quotes

Fuck Yeah! #VeteransDay #VeteransThankYou #VeteransHonoring #VeteransAppreciation #VeteransSupport #VeteransWomen #VeteransHomeless #VeteransArmy #VeteransMilitary #VeteransNavy #VeteransHusband #VeteransRespect

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

"Sam Holiday" ~ WWII Veteran & Navajo Code Talker Historia Universal, Indian Tribes, Native Indian, Native American History, Native American Indians, Code Talker, American Code, Navajo Nation, Usmc

Turquoise Jewelry

Historia UniversalIndian TribesNative IndianNative American HistoryNative American IndiansCode TalkerAmerican CodeNavajo NationUsmc

“Sam Holiday” ~ WWII Veteran & Navajo Code Talker by carleneDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

I want one of these patches.  Social Justice Whiners – Safe Space Bed Wetters Marine Corps, Military Quotes, Military Humor, Military Life, Military Personnel, Military Service, God Bless America, America America, Us Army

Marine CorpsMilitary QuotesMilitary HumorMilitary LifeMilitary PersonnelMilitary ServiceGod Bless AmericaAmerica AmericaUs Army

We All Know There Is No Real Justice In America As Long As These Self Appointed Dictator Socialist Liberals Walk The Planet.

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

#gunrights #liberals #guns #righttobeararms #molonlabe - http://www.sonsoflibertytees.com/patriotblog/gunrights-liberals-guns-righttobeararms-molonlabe/?utm_source=PN&utm_medium=Pinterest&utm_campaign=SNAP%2Bfrom%2BSons+of+Liberty+Tees%3A+A+Liberty+and+Patriot+Blog  #2Ndamendment, #Defendthesecond, #Gun, #Gunrights, #Guns, #Liberals, #Molonlabe, #Righttobeararms, #Secondamendment Leonard Nimoy, Spock, Star Trek, Tbbt, O Drama, Guns And Ammo, Pro Gun, So True, Great Quotes

#gunrights #liberals #guns #righttobeararms #molonlabe

Leonard Nimoy, Spock, Star Trek, Tbbt, O Drama, Guns And Ammo, Pro Gun, So True, Great QuotesDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Sterling Hayden-Marines-Captain-Undercover Agent in OSS-Bronze Star with Arrowhead and Silver Star (Actor) Famous Marines, Military Veterans, Military Service, Famous Veterans, Joining The Military, Hollywood Actor, Hollywood Stars, Navy Reserve, Sterling Hayden

Famous MarinesMilitary VeteransMilitary ServiceFamous VeteransJoining The MilitaryHollywood ActorHollywood StarsNavy ReserveSterling Hayden

Sterling Hayden-Marines-Captain-Undercover Agent in OSS-Bronze Star with Arrowhead and Silver Star (Actor)

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

jesus_teddy Jesus Today, My Jesus, I Love Jesus, Jesus Loves Me, Jesus Freak, Jesus Help, Trust In Jesus, God Help Me, In God We Trust

Five Keys to Discovering Your God-Given Purpose

Jesus TodayMy JesusI Love JesusJesus Loves MeJesus FreakJesus HelpTrust In JesusGod Help MeIn God We Trust

jesus_teddyDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Walter Brennan:WW1:was injured by a gas attack permanently affected his vocal chords.( cannot locate a photo) Military Veterans, Military Service, Military Men, Military History, Hollywood Men, Hollywood Stars, Classic Hollywood, Famous Veterans, Classic Tv

Military VeteransMilitary ServiceMilitary MenMilitary HistoryHollywood MenHollywood StarsClassic HollywoodFamous VeteransClassic Tv

Walter Brennan: In was injured by a gas attack which permanently affected his vocal chords.( cannot locate a photo)

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

devildoggraphix: “Two years ago today, America lost a great warrior and hero. RIP Chris Kyle. You will never be forgotten! “It was my duty to shoot the enemy, and I don’t regret it. My regrets are for... Military Humor, Military Life, Military Quotes, Military History, Usmc Quotes, Military Box, Marine Quotes, Snipers, Chris Kyle Sniper

Major League Infidel

Military HumorMilitary LifeMilitary QuotesMilitary HistoryUsmc QuotesMilitary BoxMarine QuotesSnipersChris Kyle Sniper

devildoggraphix: “Two years ago today, America lost a great warrior and hero. RIP Chris Kyle. You will never be forgotten! “It was my duty to shoot the enemy, and I don’t regret it. My regrets are for…David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Ed McMahon-Marine Reserves-WW2-Korea-1941-66-flight instructor- flew 85 combat missions, earning 6 Air Medals in Korea.Colonel/state commission as Brigadier General Military Veterans, Military Service, Military Men, Military History, Famous Veterans, Marine Reserves, Famous Men, Famous Celebrities, Ed Mcmahon

Military VeteransMilitary ServiceMilitary MenMilitary HistoryFamous VeteransMarine ReservesFamous MenFamous CelebritiesEd Mcmahon

Ed McMahon-Marine instructor- flew 85 combat missions, earning 6 Air Medals in Korea.Colonel/state commission as Brigadier General (TV Host/Announcer/Johnny Carson’s Sidekick)

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Marine Capt. Trevor J. Yurista  Died October 27, 2008 Serving During Operation Enduring Freedom  32, of Pleasant Valley, N.Y.; assigned to the 5th Marine Regiment, 1st Marine Division, I Marine Expeditionary Force, Camp Pendleton, Calif.; died Oct. 27 in Helmand province, Afghanistan, while supporting combat operations. Us Marines, Marines In Combat, Fallen Heroes, Fallen Soldiers, Remember The Fallen, Support Our Troops, American Pride, Real Hero, Marine Corps

Us MarinesMarines In CombatFallen HeroesFallen SoldiersRemember The FallenSupport Our TroopsAmerican PrideReal HeroMarine Corps

Marine Capt. Trevor J. Yurista Died October 27, 2008 Serving During Operation Enduring Freedom 32, of Pleasant Valley, N.Y.; assigned to the 5th Marine Regiment, 1st Marine Division, I Marine Expeditionary Force, Camp Pendleton, Calif.; died Oct. 27 in Helmand province, Afghanistan, while supporting combat operations.

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Phonetic Alphabet/ Morris Code...I have always wanted to learn this. haha! #nerd Phonetisches Alphabet, Alphabet Symbols, Nato Phonetic Alphabet, Sign Language Alphabet, Morse Code Learn, Code Code, Code Art, Elk Hunting, Hunting Guns

Phonetic Alphabet/ Morris have always wanted to learn this. haha! #nerd

Phonetisches AlphabetAlphabet SymbolsNato Phonetic AlphabetSign Language AlphabetMorse Code LearnCode CodeCode ArtElk HuntingHunting Guns

Phonetic Alphabet/ Morris Code…I have always wanted to learn this. Phonetic Alphabet/ Morris Code…I have always wanted to learn this.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

William Holden served in Army Air Services in WWII Old Hollywood Stars, Hollywood Actor, Classic Hollywood, Vintage Hollywood, Military Veterans, Military Service, Military Men, Military History, Military Personnel

Peer Into The Past

Old Hollywood StarsHollywood ActorClassic HollywoodVintage HollywoodMilitary VeteransMilitary ServiceMilitary MenMilitary HistoryMilitary Personnel

William Holden served as a lieutenant in the US Army Air Corps during World War II.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Jackie Cooper-Navy-WW2-South Pacific-active in the reserves for many years, Rank of Captain-Legion of Merit (Actor) Famous Men, Famous Celebrities, Famous People, Hollywood Actor, Hollywood Stars, Military Veterans, Military Service, Joining The Military, American Actors

Famous MenFamous CelebritiesFamous PeopleHollywood ActorHollywood StarsMilitary VeteransMilitary ServiceJoining The MilitaryAmerican Actors

Jackie Cooper, Navy, South Pacific, active in the reserves for many years, Rank of Captain-Legion of Merit.

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Just that Once A Marine, Marine Mom, Us Marine Corps, Marine Corps Humor, Marine Quotes, Usmc Quotes, Military Humor, Military Quotes, Military Life

Once A MarineMarine MomUs Marine CorpsMarine Corps HumorMarine QuotesUsmc QuotesMilitary HumorMilitary QuotesMilitary Life

“Y el 8 día Dios creó los Marines, el diable rugió y dijó.”Oh mierda”

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Military Vets - KNOCK KNOCK! MARINES! Military Humor, Army Humor, Military Life, Military Box, Army Life, Troops, Marine Core, Knock Knock, Funny Army

Log In or Sign Up to View

Military HumorArmy HumorMilitary LifeMilitary BoxArmy LifeTroopsMarine CoreKnock KnockFunny Army

Smilin’ and wavin’David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

RED NECK HAVING FUN Liberal Hypocrisy, Politicians, Liberal Logic, Gun Quotes, Truck Quotes, Liberalism, Pro Gun, 2nd Amendment, Gun Rights


Liberal HypocrisyPoliticiansLiberal LogicGun QuotesTruck QuotesLiberalismPro Gun2nd AmendmentGun Rights

Add murder by scalpel (abortions) to the tune of Almost a million per year in the US!David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Dv “s” s - Google+ Real Life Heros, Memes In Real Life, Reality Of Life, Truth Of Life, True Quotes, Apj Quotes, Motivational Quotes, Inspirational Quotes, Funny Quotes

Real Life HerosMemes In Real LifeReality Of LifeTruth Of LifeTrue QuotesApj QuotesMotivational QuotesInspirational QuotesFunny Quotes

I dont know if this is real or not but it made me tremble.

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Henry Mancini. US Army Air Corps. World War II. Musician Military Veterans, Military Service, Famous Veterans, Henry Mancini, Joining The Military, Armed Forces, Military History, Famous Men, World War Ii

Henry Mancini – Biography

Military VeteransMilitary ServiceFamous VeteransHenry ManciniJoining The MilitaryArmed ForcesMilitary HistoryFamous MenWorld War Ii

Henry Mancini-Army Air Composer of the dreamy “Moon River” and more greatmusic.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

High end, luxury art prints from Comics, Film and more. Limited Editions and hand-signed - these make the most amazing gifts for that discerning geek in your life. Star Trek Characters, Amazing Gifts, Sideshow Collectibles, Star Wars Art, Geek Culture, Asoka Tano, Recommended Reading, Carrie Fisher, Chopsticks

Art Prints

Star Trek CharactersAmazing GiftsSideshow CollectiblesStar Wars ArtGeek CultureAsoka TanoRecommended ReadingCarrie FisherChopsticks

High end, luxury art prints from Comics, Film and more. Limited Editions and hand-signed – these make the most amazing gifts for that discerning geek in your life.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Marine Cpl. James L. Moore Died January 26, 2005 Serving During Operation Iraqi Freedom, 24, of Roseburg, Ore.; assigned to 1st Battalion, 3rd Marine Regiment, 3rd Marine Division, III Marine Expeditionary Force, Marine Corps Base Hawaii; killed Jan. 26 when the CH-53E helicopter in which he was riding crashed near Rutbah, Iraq. Twenty-nine Marines and one sailor also were killed. Marine Corps Bases, Hero's Journey, Real Hero, January 26, Fallen Heroes, Home Of The Brave, American Soldiers, God Bless America, Armed Forces

Marine Corps BasesHero’s JourneyReal HeroJanuary 26Fallen HeroesHome Of The BraveAmerican SoldiersGod Bless AmericaArmed Forces

Heroes journey essay assignment on respect Sep 2013 ·. The Hero’s Journey, writing assignment, ideas from the essay “The Hero’s Journey,” but you are able. Wednesday Homework, The Hero’s Journey.

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Repentance is NOT when you cry. Repentance is when you CHANGE! #Repentance Lord And Savior, True Repentance, Forgiveness In The Bible, Forgiveness Quotes Christian, Christian Quotes, Faith Quotes, Life Quotes Love, Bible Quotes, Biblical Quotes

2:57Lord And SaviorTrue RepentanceForgiveness In The BibleForgiveness Quotes ChristianChristian QuotesFaith QuotesLife Quotes LoveBible QuotesBiblical Quotes

#ChristianQuotes #BibleQuotes

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

What to do about Your Liberal Friends WordPress, Common Sense, Pro Gun, Freedom, Gun Rights, Gun Control, Self Defense, 2nd Amendment, Guns And Ammo

WordPressCommon SensePro GunFreedomGun RightsGun ControlSelf Defense2nd AmendmentGuns And Ammo

History and Statistics Prove That Gun Bans and Gun Control Legislation are Dangerous to Freedom & Liberty.

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

cf67d1c4ff2747bd91dc2d69513c895a.jpg 640×853 pixels Poppies Poem, Veterans Day Poppy, Veterans Day Activities, Memorial Day Activities, Remembrance Day Activities, Holiday Activities, Remembrance Sunday, Remembrance Day Quotes, Thinking Day

Poppies PoemVeterans Day PoppyVeterans Day ActivitiesMemorial Day ActivitiesRemembrance Day ActivitiesHoliday ActivitiesRemembrance SundayRemembrance Day QuotesThinking Day

Memorial Day Poppy & Poem Make them into pins for the kids to wear Supplies: Red Paper Sharpie Scissors Glue Safety Pins Poem: Print on a ribbon?

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

  Marine Corps Memes, Us Marine Corps, Military Jokes, Military Veterans, Military Life, Marines Funny, Us Marines, Usmc Humor, Once A Marine

Marine Corps Memes, Us Marine Corps, Military Jokes, Military Veterans, Military Life, Marines Funny, Us Marines, Usmc Humor, Once A Marine

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Funny Pictures brought to you by LolSnaps. Constant updates of the best funny pictures on the web. I Smile, Make Me Smile, Sincerity, Believe, Look At You, All That Matters, No Me Importa, A Good Man, This Man

Good guy soldier

I SmileMake Me SmileSincerityBelieveLook At YouAll That MattersNo Me ImportaA Good ManThis Man

This man!” It always restores my faith in humanityDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Lex Barker-Army-WW2-rank of Major-he was wounded in action (Actor) Military Veterans, Military Service, Famous Veterans, Joining The Military, Famous Names, Hollywood Actor, Old Hollywood, American Presidents, Acting Career

Military VeteransMilitary ServiceFamous VeteransJoining The MilitaryFamous NamesHollywood ActorOld HollywoodAmerican PresidentsActing Career

Lex of Major-he was wounded in action (Actor)

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Sgt. Major Jiggs 1925; English bulldog & the first mascot of U.S. Marines… Bulldog Names, Bulldog Mascot, Bulldog Puppies, Marine Mom, Us Marine Corps, Us Marines, Usmc, Semper Fidelis, Was

Bulldog NamesBulldog MascotBulldog PuppiesMarine MomUs Marine CorpsUs MarinesUsmcSemper FidelisWas

The first mascot of the United States marines was an English Bulldog named King Bulwark. kings formal title was dropped at his enlistment in.

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

The Surprising True History Behind Flag Day #history I Love America, God Bless America, Lest We Forget, Always Remember, We Will Never Forget, We Remember, American Pride, American History, American Freedom

The Surprising True History Behind Flag Day

I Love AmericaGod Bless AmericaLest We ForgetAlways RememberWe Will Never ForgetWe RememberAmerican PrideAmerican HistoryAmerican Freedom

I will always remember this New York skyline.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Dan Blocker (December 10, 1928 – May 13, 1972) was drafted into the United States Army during the Korean War. He served as an Infantry sergeant in F Company, 2nd Battalion, 179th Infantry Regiment, 45th infantry Division in Korea, December 1951 to August 1952. He received a Purple Heart for wounds in combat Bonanza Tv Show, Famous Veterans, Hollywood Actor, Classic Hollywood, Old Hollywood, Hollywood Stars, The Lone Ranger, Old Tv Shows, Michael Landon

Bonanza Tv ShowFamous VeteransHollywood ActorClassic HollywoodOld HollywoodHollywood StarsThe Lone RangerOld Tv ShowsMichael Landon

Dan Blocker “Hoss Cartright” served US Army in the Infantry Division during WWII also recieved the Purple Heart medal

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Come in Bible Pictures, Biblical Art, Heart Of Jesus, God Jesus, Pictures Of Jesus Christ, Image Jesus, In Christ Alone, Jesus Loves You, Son Of God

Bible PicturesBiblical ArtHeart Of JesusGod JesusPictures Of Jesus ChristImage JesusIn Christ AloneJesus Loves YouSon Of God

Jesus is waiting If you’re broken down Jesus is waiting, hey yeah Don’t let y.

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Have You Seen the ‘Guns Are Welcome’ Sign That’s Burning up the Internet?You might have seen signs at certain establishments letting customers know they welcome things like pets or strollers. But there’s a new sort of welcome sign that has begun to go viral on the Internet recently: a welcome sign for guns. Sayings, Pro Gun, Gun Rights, Gun Control, Self Defense, Concealed Carry, 2nd Amendment, Cool Guns, Awesome Guns

Lindsay Graham says he’ll make Putin “pay a price” for election interference

SayingsPro GunGun RightsGun ControlSelf DefenseConcealed Carry2nd AmendmentCool GunsAwesome Guns

that is the freedom to bear arms! I suppose its not really that funny that we don’t see these signs more often.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Everyone is born different We Are The World, In This World, Make Me Happy, Make Me Smile, For King And Country, Just Dream, All That Matters, Funny Pictures, Funny Images

Everyone is born different

We Are The WorldIn This WorldMake Me HappyMake Me SmileFor King And CountryJust DreamAll That MattersFunny PicturesFunny Images

This is one beautiful person. So so beautiful. I wish more people had her thought of mind. Its amazing how positive people can be.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Col Gregory Gadson, a double amputee, took command of Fort Belvoir. American Veterans, American Soldiers, Fort Belvoir, Army History, Black History, Prosthetic Leg, Wounded Warrior, Life Goes On, Home Of The Brave

American VeteransAmerican SoldiersFort BelvoirArmy HistoryBlack HistoryProsthetic LegWounded WarriorLife Goes OnHome Of The Brave

For the first time in the Army’s history, a double amputee has taken the reins as garrison commander of a major installation.

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Image Fantastic Fox, Fabulous Fox, Cute Fox, Wild Dogs, Mammals, Baby Animals, Funny Animals, Cute Animals, Animals And Pets

Fox on

Fantastic FoxFabulous FoxCute FoxWild DogsMammalsBaby AnimalsFunny AnimalsCute AnimalsAnimals And Pets

All of These Foxes! — foxy-lover: Comfortable place to sleepDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Lee Marvin (February 19, 1924 – August 29, 1987) American actor, known for his gravelly voice, white hair & 6 ft 2 in. stature. He join the US Marine Corps, serving in the 4th Marine Division. He was wounded in action during the WWII Battle of Saipan, in the assault on Mount Tapochau, during which most of his "I" Company, 24th Marines, 4th Marine Division were killed. He was awarded the Purple Heart & given a medical discharge with rank of PFC. by karyn Military Veterans, Military Service, Military Ranks, Military Life, Usmc, Marines, Battle Of Saipan, Famous Veterans, Us Marine Corps

Military VeteransMilitary ServiceMilitary RanksMilitary LifeUsmcMarinesBattle Of SaipanFamous VeteransUs Marine Corps

Lee Marvin left school and joined the US Marine Corps as a sniper scout. He was wounded in action at the Battle of Saipan during WWII and was awarded the Purple Heart and discharged at the rank of Private First Class.

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

  Military Quotes, Military Humor, Army Quotes, Army Humor, Military Pictures, Military Life, Bible Quotes, Airborne Army, Army Infantry

Military Quotes, Military Humor, Army Quotes, Army Humor, Military Pictures, Military Life, Bible Quotes, Airborne Army, Army Infantry

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Thank you, Terminal Lance, for this gem. Funny Military, Military Humour, Army Humor, Marines Funny, Us Marines, Military Police, Army Funny, Military Salute, Female Marines

Funny MilitaryMilitary HumourArmy HumorMarines FunnyUs MarinesMilitary PoliceArmy FunnyMilitary SaluteFemale Marines

USMC Inter-Service Humor targeting the Air Force

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

U.S. Marines - please continue to complain about terrible YOUR day at work. Marines Funny, Us Marines, Military Suit, Marine Baby, Once A Marine, Marines Girlfriend, Us Marine Corps, Marine Humor, Support Our Troops

Marines FunnyUs MarinesMilitary SuitMarine BabyOnce A MarineMarines GirlfriendUs Marine CorpsMarine HumorSupport Our Troops

3 most important things: Rifle, laptop, and water

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

True life hero... Let people like him be never forgotten Sweet Stories, Cute Stories, Amazing People Stories, Real Hero, Real Life Heros, Good People, Funny People, Special People, Human Kindness

True life hero… Let people like him be never forgotten

Sweet StoriesCute StoriesAmazing People StoriesReal HeroReal Life HerosGood PeopleFunny PeopleSpecial PeopleHuman Kindness

So sad:/ True life hero. Let people like him be never forgottenDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Bushtec Pull Behind Motorcycle Trailer for the Dogs! Motorcycle Cargo Trailer, Pull Behind Motorcycle Trailer, Motorcycle Camping, Motorcycle Garage, Teardrop Trailer Plans, Dog Trailer, Cargo Trailer Conversion, Cafe Bike, Cargo Trailers


Bushtec Motorcycle Trailers | Made in the USA

Motorcycle Cargo TrailerPull Behind Motorcycle TrailerMotorcycle CampingMotorcycle GarageTeardrop Trailer PlansDog TrailerCargo Trailer ConversionCafe BikeCargo Trailers

Bushtec Pull Behind Motorcycle Trailer for the Dogs!David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Thank you active, veteran, retired, and reservist military members, for your service. We’re proud to show our appreciation with 10% off any Purple order for you and your dependents. Military Homecoming, Navy Military, Military Spouse, Doomsday Survival, Us Army Rangers, Joining The Military, Homecoming Pictures, Marines Girlfriend, Navy Air Force

Shop With Purple Mattress Military Discount

Military HomecomingNavy MilitaryMilitary SpouseDoomsday SurvivalUs Army RangersJoining The MilitaryHomecoming PicturesMarines GirlfriendNavy Air Force

Thank you active, veteran, retired, and reservist military members, for your service. We’re proud to show our appreciation with 10% off any Purple order for you and your dependents.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

"Every Marine a Rifleman" (but not all are 0311) Marine Corps History, Us Marine Corps, American Uniform, Ww1 Soldiers, Wwi, Once A Marine, Military Humor, Military History, Us Marines

Marine Corps HistoryUs Marine CorpsAmerican UniformWw1 SoldiersWwiOnce A MarineMilitary HumorMilitary HistoryUs Marines

“Every Marine a Rifleman” (but not all are

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Freedom's Sisters- Harriet Tubman (1820-1913) Underground Railroad, American Women, African American History, Harriet Tubman, John Tubman, Great Women, Amazing Women, American Civil War, Black People

Freedom’s Sisters, Twenty Great African American Women

Underground RailroadAmerican WomenAfrican American HistoryHarriet TubmanJohn TubmanGreat WomenAmazing WomenAmerican Civil WarBlack People

Harriet Tubman is an influential African American because she escaped from slavery to become a leading abolitionist and created the Underground Railroad.” The Biography Channel website.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Mary Mahoney, first African American nurse Black History Month, Black History Facts, Women In History, African American History, Held, African American Women, African Americans, Look At You, Black Pride

Top 10 Famous Nurses

Black History MonthBlack History FactsWomen In HistoryAfrican American HistoryHeldAfrican American WomenAfrican AmericansLook At YouBlack Pride

Mary Eliza Mahoney, R. ~ May 1845 – January, 1926 Among the first women in Boston to register to vote Mary Mahoney, born in Boston in was the first black to study and work as a professionally trained nurse in the United States, graduating inDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Dependapotomus in their natural habitat. | iHateTheUSMC Military Memes, Funny Military, Marines Funny, Military Life, Army Life, Military Service, Marine Corps Humor, Usmc Humor, Dad Humor

Military MemesFunny MilitaryMarines FunnyMilitary LifeArmy LifeMilitary ServiceMarine Corps HumorUsmc HumorDad Humor

A dependapotomus spotted in the wild . Browse new photos about A dependapotomus spotted in the wild . Most Awesome Funny Photos Everyday!

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Lee Marvin USMC | Marvin-L-aged-20-I-Company-24th-Marines-4th-Marine-Division Military Veterans, Military Service, Military Ranks, Military Life, Usmc, Marines, Battle Of Saipan, Famous Veterans, Us Marine Corps

Wartime Photo of Lee Marvin – American Actor and Grade A Badass

Military VeteransMilitary ServiceMilitary RanksMilitary LifeUsmcMarinesBattle Of SaipanFamous VeteransUs Marine Corps

Lee Marvin left school and joined the US Marine Corps as a sniper scout. He was wounded in action at the Battle of Saipan during WWII and was awarded the Purple Heart and discharged at the rank of Private First Class.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Navajo Code Talkers were honored on Memorial Day 2011 at Veterans Park in Las Cruces. Native American Wisdom, Native American History, American Indians, American Code, Code Talker, Mexico People, Japanese American, Indian Tribes, Semper Fi

Native American WisdomNative American HistoryAmerican IndiansAmerican CodeCode TalkerMexico PeopleJapanese AmericanIndian TribesSemper Fi

New Mexico

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Charles Bronson Charles Durning, Famous Veterans, Charles Bronson, Military Photos, Military History, Military Service, American War, Famous Faces, Guam

Charles DurningFamous VeteransCharles BronsonMilitary PhotosMilitary HistoryMilitary ServiceAmerican WarFamous FacesGuam

Charles Bronson – American Film Actor Charles Bronson enlisted in the US Army Air Forces in 1943 and served as an aerial gunner. In 1945 he was based on Guam as a Superfortress crewman and was awarded a Purple Heart for wounds received during his servic

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

75 Inspirational Quotes About Race, Love & Equality To Celebrate Black History Month | YourTango American History Lessons, African American History Month, History For Kids, Black History Month Quotes, Black History Month Activities, Life Quotes Love, World History Classroom, History Teachers, WordPress

75 Inspirational Quotes From The World’s Greatest Leaders To Celebrate Black History Month

American History LessonsAfrican American History MonthHistory For KidsBlack History Month QuotesBlack History Month ActivitiesLife Quotes LoveWorld History ClassroomHistory TeachersWordPress

75 Inspirational Quotes About Race, Love & Equality To Celebrate Black History Month | YourTangoDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

The Best Advice From Social Media | The Odyssey It Doesnt Matter, Sincerity, This Is Your Life, All That Matters, Verbatim, Quotable Quotes, Motivational Quotes, Inspirational Quotes, Humorous Quotes

The Best Advice From Social Media

It Doesnt MatterSincerityThis Is Your LifeAll That MattersVerbatimQuotable QuotesMotivational QuotesInspirational QuotesHumorous Quotes

Bad news is: you cannot make people like, love, understand, validate, accept or be nice to you. You can’t control them either. Good news is: it doesn’t matterDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Soul Surfer: The Bethany Hamilton Story -- Inspiring People, Books and Films Bethany Hamilton, Surf Mar, Soul Surfer, Surf Girls, Beach Girls, Christian Inspiration, Surfs Up, Surfing, Good People

Soul Surfer Bethany Hamilton: Inspirational Christian Athlete

Bethany HamiltonSurf MarSoul SurferSurf GirlsBeach GirlsChristian InspirationSurfs UpSurfingGood People

Soul Surfer: The Bethany Hamilton Story — Inspiring People, Books and Films, champion surfer that lost her arm to a shark, despite that returned to competing.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

  Military Wife, Army Mom, I Love America, God Bless America, Usa Flag Wallpaper, American Flag Wallpaper, Patriotic Pictures, Marines, Usmc

Military Wife, Army Mom, I Love America, God Bless America, Usa Flag Wallpaper, American Flag Wallpaper, Patriotic Pictures, Marines, Usmc

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Long_Layered_Bob_Hairstyle_2011_6.jpg 700×826 pixels Choppy Bob With Bangs, Heavy Bangs, Short Hair With Bangs, Haircuts With Bangs, Bob Haircuts, Blunt Bangs, Blunt Fringe, Long Face Haircuts, Short Choppy Bobs

Choppy Bob With BangsHeavy BangsShort Hair With BangsHaircuts With BangsBob HaircutsBlunt BangsBlunt FringeLong Face HaircutsShort Choppy Bobs

A short brown straight choppy Rock-Chick Womens haircut hairstyle by Jean Louis David

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

VIETNAM WAR UNITED STATES ARMY MILITARY VETERAN UNIT & OPERATION SHIRT North Vietnam, Vietnam War, Military Veterans, Military Art, Howard Hughes, Navy Air Force, Paratrooper, United States Army, Assassins Creed



North Vietnam, Vietnam War, Military Veterans, Military Art, Howard Hughes, Navy Air Force, Paratrooper, United States Army, Assassins CreedDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

  Army Quotes, Military Quotes, Military Humor, Military Life, Military Art, Us Army, Army Infantry, Military Tattoos, Military Veterans

Army Quotes, Military Quotes, Military Humor, Military Life, Military Art, Us Army, Army Infantry, Military Tattoos, Military Veterans

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

The remains of an American hero were finally flown home from Vietnam this week. His son was the pilot. - TheBlaze Missing In Action, Killed In Action, Vietnam Vets, Southwest Airlines

The remains of an American hero were finally flown home from Vietnam this week. His son was the pilot.

Missing In ActionKilled In ActionVietnam VetsSouthwest Airlines

The remains of an American hero were finally flown home from Vietnam this week. His son was the pilot. – TheBlazeDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Code Talker Navajo Weaving, Navajo Rugs, Code Talker, Navajo People, Taos New Mexico, Navajo Nation, American Story, Land Of Enchantment, Mystery Of History

Navajo Code Talkers

Navajo WeavingNavajo RugsCode TalkerNavajo PeopleTaos New MexicoNavajo NationAmerican StoryLand Of EnchantmentMystery Of History

Code TalkerDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Image Wolf Hybrid, Fennec, Spirit Animal, Stuffed Animals, Save Wildlife, Mundo Animal, Fox Animal, Funny Animals, Animals And Pets

Fox on

Wolf HybridFennecSpirit AnimalStuffed AnimalsSave WildlifeMundo AnimalFox AnimalFunny AnimalsAnimals And Pets

Burgess Animal Book for Children Learning GuideDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

The Father Archives • Into the Light Adventures %

The Father Archives • Into the Light Adventures %

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

now 'm thinkin' dirty stuff...  JK!

now ‘m thinkin’ dirty stuff… JK!

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

IN HONOR OF ALL OF OUR ARMED FORCES - My Heart and Soul for this couple - Peace  Love Touching Stories, Sweet Stories, Sad Stories, Awesome Stories, Faith In Humanity Restored Military, Human Kindness, Usmc, Good People, Stupid People

Touching StoriesSweet StoriesSad StoriesAwesome StoriesFaith In Humanity Restored MilitaryHuman KindnessUsmcGood PeopleStupid People

it left me in tears.

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

20 Amazing Quotes About Life Superb Quotes, Amazing People Quotes, Quotes About Mean People, Inspiring People Quotes, Best Quotes, Favorite Quotes, Quotes About Ignorant People, Truth Quotes Life, Cheap People Quotes

20 Amazing Quotes About Life

Superb QuotesAmazing People QuotesQuotes About Mean PeopleInspiring People QuotesBest QuotesFavorite QuotesQuotes About Ignorant PeopleTruth Quotes LifeCheap People Quotes

20 Amazing Quotes About Life Yes my boyfriend have learn me this noy always arguing en when walk alway from it and let people who are wrong be and stand above it.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

This "screamed" Montessori to me! When a child misbehaved at free-choice time, I instructed my staff to "fix" or restructure the environment. Wisdom Quotes, Quotable Quotes, Confucius Quotes, Positive Quotes, Motivational Quotes, Me Quotes, Message Quotes, Love For Child Quotes, Flower Child Quotes

Your Essential QUOTES Collections of All Time

Wisdom QuotesQuotable QuotesConfucius QuotesPositive QuotesMotivational QuotesMe QuotesMessage QuotesLove For Child QuotesFlower Child Quotes

This “screamed” Montessori to me! When a child misbehaved at free-choice time, I instructed my staff to “fix” or restructure the environment.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

He wanted to join the Marines, but he was too short. The paratroopers wouldn’t… American History, History Facts, World History, World War Ii, American Pride, Military Memes, Military History, Military Dogs, Fun Facts

He Was Just 16 But He Became the Most Decorated WWII Soldier

American HistoryHistory FactsWorld HistoryWorld War IiAmerican PrideMilitary MemesMilitary HistoryMilitary DogsFun Facts

His name was Audie Murphy. Like so many other young men wanting to fight for their country, Audie Murphy lied about his age in his attempt to enlist. But it was not his age that kept him out of the Marines;David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Quotes No one is more hated than he who speaks the truth. Speak The Truth Quotes, Telling The Truth Quotes, Wise Quotes, Quotable Quotes, Fool Quotes, Socrates Quotes, Famous Quotes, Truth And Lies, Motivational Quotes

No one is more hated than he who speaks the truth | Quotes – Quotes

Speak The Truth QuotesTelling The Truth QuotesWise QuotesQuotable QuotesFool QuotesSocrates QuotesFamous QuotesTruth And LiesMotivational Quotes

Quotes No one is more hated than he who speaks the truth.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

25 Inspirational Advice Given By The Pets In Your Life - I Can Has Cheezburger? I Like Dogs, Inspirierender Text, Dog Life, Quote Posters, Quotable Quotes, Motivational Quotes, Inspirational Quotes, Positive Quotes, Decir No

25 Inspirational Advice Given By The Pets In Your Life

I Like DogsInspirierender TextDog LifeQuote PostersQuotable QuotesMotivational QuotesInspirational QuotesPositive QuotesDecir No

Discover and share Dog Quotes By Mark Twain. Explore our collection of motivational and famous quotes by authors you know and love.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

I've noticed this a lot browsing Imgur and I wanted to correct it without being rude. - Imgur Military Wife, Military Humor, Military Uniforms, Navy Uniforms, Navy Military, Military Families, Military Service, Military Quotes, Coast Guard Uniforms

I’ve noticed this a lot browsing Imgur and I wanted to correct it without being rude.

Military WifeMilitary HumorMilitary UniformsNavy UniformsNavy MilitaryMilitary FamiliesMilitary ServiceMilitary QuotesCoast Guard Uniforms

The United States Military: Soldier = Army, Sailor = Navy, Airman = Airforce, Coastguardsman = Coastguard, and Marine = Marine CorpsDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Associate yourself with people of good quality, for it is better to be alone than in bad company. - Booker T.  Washington Be Wise Quotes, Being Smart Quotes, Quotes Of Wisdom, Inspirational And Motivational Quotes, Inspirational Thoughts, Wiser Quotes, People Quotes, Quotable Quotes, Great Quotes

100 Inspirational and Motivational Quotes of All Time! (18)

Be Wise QuotesBeing Smart QuotesQuotes Of WisdomInspirational And Motivational QuotesInspirational ThoughtsWiser QuotesPeople QuotesQuotable QuotesGreat Quotes

I have a thief with a bad mouth. A vagabond who’d do anything for a dime, including slavery. Another mathmatician plus politician who puts his left hand in everything and anything. A psychopath! And a highly diplomatic dwarf! As my daily companion!David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Positive quotes about strength, and motivational Wisdom Quotes, Quotable Quotes, Words Quotes, Quotes To Live By, Motivational Quotes, Wise Words, Life Quotes, Inspirational Quotes, Plato Quotes

10 Inspirational Quotes Of The Day (542)

Wisdom QuotesQuotable QuotesWords QuotesQuotes To Live ByMotivational QuotesWise WordsLife QuotesInspirational QuotesPlato Quotes

Positive quotes about strength, and motivationalDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

R. Lee Ermey spent 11 years in the Marines-Vietnam in 1968 for 14 months-staff Sergeant and medically retired for injuries received. The first Marine to ever be promoted after retirement.   He is an actor and advisor on many movies. Military Veterans, Military Service, Military Men, Military Humor, Vietnam Veterans, Vietnam War, Military History, Anime Military, Famous Veterans

Military VeteransMilitary ServiceMilitary MenMilitary HumorVietnam VeteransVietnam WarMilitary HistoryAnime MilitaryFamous Veterans

Lee Ermey spent 11 years in the Marines-Vietnam in 1968 for 14 months-staff Sergeant and medically retired for injuries received. The first Marine to ever be promoted after retirement. He is an actor and advisor on many movies. FROM EMPORIA KS

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Jack Warden-Navy and Army-WW2-a member of the 101st Airborne Jack Warden, Military Veterans, Military Service, Famous Veterans, Merchant Marine, Paratrooper, Real Hero, American Soldiers, Us Army

Jack WardenMilitary VeteransMilitary ServiceFamous VeteransMerchant MarineParatrooperReal HeroAmerican SoldiersUs Army

Jack Warden-Navy and member of the Airborne 1920 – American character actor

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

John McCain, recently released after 5 years in Hanoi Hilton, meets Pres. Nixon in 1973. On May 24 of that year, Nixon had a huge White House gala to celebrate the homecoming of the POWs. World History, History Books, American Presidents, Us Presidents, American History, American Soldiers, American Pride, Senator Mccain, Vietnam War

Nixon Presidential Library recreates White House gala for 200 Vietnam POWs to mark the 40th anniversary of their release

World HistoryHistory BooksAmerican PresidentsUs PresidentsAmerican HistoryAmerican SoldiersAmerican PrideSenator MccainVietnam War

WALKING WOUNDED: McCain’s torture left him disfigured and permanently disabled. He’s pictured being greeted by then-President Richard Nixon upon his release in 1973David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

David Janssen (March 27, 1931 – February 13, 1980) was an American film and television actor. He served two years as an enlisted man in the United States Army. Military Veterans, Military Service, Famous Veterans, Joining The Military, Famous Men, Famous Faces, Janssen, Hollywood Stars, Classic Hollywood

Military VeteransMilitary ServiceFamous VeteransJoining The MilitaryFamous MenFamous FacesJanssenHollywood StarsClassic Hollywood

David Janssen (March 1931 – February was an American film and television actor. He served two years as an enlisted man in the United States Army.

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

This represents that God can defeat anyone and anything no matter how big or small. No matter how strong or weak. Christian Jokes, Christian Rock Bands, Christian Singers, Christian Music, Christian Life, Jesus Army, Skillet Band, Jesus Loves Me, God Loves Me

Jesus Name News

Christian JokesChristian Rock BandsChristian SingersChristian MusicChristian LifeJesus ArmySkillet BandJesus Loves MeGod Loves Me

John cooper (skillet) (right) and Toby Mac (left). Just wait until you see Jesus’ army.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

you have to build a wall because you better believe they are TRYING to get you worked up. Great Quotes, Wise Quotes, Art Of War Quotes, Quotable Quotes, Wisdom Sayings, Motivational Quotes, Insightful Quotes, Inspirational Quotes, Quotes Pics

Is insulin resistance standing between you and your healthier self? – 30 day die

Great QuotesWise QuotesArt Of War QuotesQuotable QuotesWisdom SayingsMotivational QuotesInsightful QuotesInspirational QuotesQuotes Pics

Any person capable of angering you becomes your aster; he can anger you only when you permit yourself to be disturbed by him.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Sir Philip Anthony Hopkins (born 31 December 1937) is a Welsh actor of film, stage, and television, and a composer and painter. He spent two years in the British Army doing his national service. Anthony Hopkins, Military Veterans, Military Service, Famous Veterans, Hollywood Actor, Hollywood Stars, Classic Hollywood, Old Hollywood, Classic Films

Anthony HopkinsMilitary VeteransMilitary ServiceFamous VeteransHollywood ActorHollywood StarsClassic HollywoodOld HollywoodClassic Films

Sir Philip Anthony Hopkins (born 31 December is a Welsh actor of film, stage, and television, and a composer and painter. He spent two years in the British Army doing his national service.

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Johnny Carson-Navy-WW2-1943-USS Pennsylvania in the Pacific. Communications officer in charge of decoding encrypted messages/He also Boxed while in the Navy. American Soldiers, Military History, Classic Hollywood, Hollywood Stars, Classic Tv, Military Service, Military Veterans, Military Men, Famous Veterans

American SoldiersMilitary HistoryClassic HollywoodHollywood StarsClassic TvMilitary ServiceMilitary VeteransMilitary MenFamous Veterans

Johnny Carson / U.Navy WWII 1943 on USS Pennsylvania in the Pacific. Communications officer in charge of decoding encrypted messages.

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Carlos Ray "Chuck" Norris (born March 10, 1940) is an American martial artist and actor. He joined the United States Air Force as an Air Policeman in 1958 and was sent to Osan Air Base, South Korea. It was there that Norris acquired the nickname Chuck and began his training in Tang Soo Do, an interest that led to black belts in that art and the founding of the Chun Kuk Do ("Universal Way") form. Norris was discharged in August 1962. Military Service, Military Veterans, Military Art, Hollywood Actor, Hollywood Stars, Classic Hollywood, Famous Men, Famous People, Famous Faces

Military ServiceMilitary VeteransMilitary ArtHollywood ActorHollywood StarsClassic HollywoodFamous MenFamous PeopleFamous Faces

Carlos Ray “Chuck” Norris (born March is an American martial artist…

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Barry Corbin (born Leonard Barrie Corbin; October 16, 1940), is an American actor.  At 21, he joined the United States Marine Corps, served two years and then returned to college. He was in the Marine Corp Reserve until 1962 as an assistant Browning Automatic Rifleman. Military Service, Military Veterans, Military Men, Military History, Joining The Military, American Soldiers, American Actors, Famous Marines, Support Our Troops

Military ServiceMilitary VeteransMilitary MenMilitary HistoryJoining The MilitaryAmerican SoldiersAmerican ActorsFamous MarinesSupport Our Troops

Barry Corbin: at 21 he joined the United States Marine Corps, served two years & then returned to college. He was in the Marine Corp Reserve until 1962 as an assistant Browning Automatic Rifleman.

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

He will keep them in Perfect Peace whose mind is stayed on Him... Guarding our hearts and minds through Christ Jesus.. Amen, every minute, hour, day, week... Always... All That Matters, Family Matters, Praise God, Godly Woman, Encouragement Quotes, Faith Quotes, Me Quotes, Bible Quotes, Queen Quotes

All That MattersFamily MattersPraise GodGodly WomanEncouragement QuotesFaith QuotesMe QuotesBible QuotesQueen Quotes

He will keep them in Perfect Peace whose mind is stayed on Him. Guarding our hearts and minds through Christ Jesus. Amen, every minute, hour, day, week.

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

I ONLY CARE WHAT MY LORD JESUS THINKS: "Do you not know that if you present yourselves to anyone as obedient slaves, you are slaves of the one whom you obey, either of sin, which leads to death, or of obedience, which leads to righteousness?" Romans 6:16. Wisdom Quotes, Quotable Quotes, Quotes To Live By, Life Quotes, Taoism Quotes, Lao Tzu Quotes, Long Distance Love, Bien Dit, Verbatim

Facebook: http://on.fb.me/Y86UBd Google+: http://bit.ly/10l37o8 Twitter: http://bit.ly/Y86TgB #Quotes #Sayings #Inspire #Love #Quote #LoveQuotes #Inspiration #Life #MotivationQuotes #InspirationQuotes #Saying #LifeQuotes #Motivation #Inspirational #Philos

Wisdom QuotesQuotable QuotesQuotes To Live ByLife QuotesTaoism QuotesLao Tzu QuotesLong Distance LoveBien DitVerbatim

Care about what other people think and you will always be their prisoner – Lao TzuDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Walt Disney-WW1-rejected by the Army for being too young, he joined the Red Cross. Sent to France for a year where he drove ambulances-1918. Military Veterans, Military Service, Famous Veterans, Joining The Military, People Of Interest, World War One, Red Cross, Military History, Armed Forces

Military VeteransMilitary ServiceFamous VeteransJoining The MilitaryPeople Of InterestWorld War OneRed CrossMilitary HistoryArmed Forces

Walt Disney the famous Disney movie this is his true story about him. during world war 1 he jointed Red Cross

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Kris Kristofferson-Army-Captain-helicopter pilot, Ranger school-turned down teacher assignment at West Point (Musician) Military Veterans, Military Service, Famous Veterans, Celebrities Then And Now, Young Celebrities, Joining The Military, Vietnam War Photos, Famous Men, Famous Faces

Military VeteransMilitary ServiceFamous VeteransCelebrities Then And NowYoung CelebritiesJoining The MilitaryVietnam War PhotosFamous MenFamous Faces

Kris Kristofferson-Army-Captain-helicopter pilot, Ranger school-turned down teacher assignment at West Point (Musician)

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

To much of our culture, Easter means eggs, bunnies and lots of chocolate, but we know that none of that compares to the victory of Jesus the day he conquered death and the grave. Enjoy another round of memes with us as we remember the main reason for the Easter holiday! Christian Humor, Christian Life, Christian Friends, Funny Christian Jokes, Religion Catolica, Our Lady, Soli Deo Gloria, Gods Not Dead, Jesus Cristo

5 Easter Memes Every Christian Will Understand

Christian HumorChristian LifeChristian FriendsFunny Christian JokesReligion CatolicaOur LadySoli Deo GloriaGods Not DeadJesus Cristo

The 50 best Christian memes from Memes for JesusDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Brian Kieth-Marine-WW2-aerial Gunner in Pacific including Rabal (Actor) Military Veterans, Military Service, Military Men, Famous Veterans, Brian Keith, Hollywood Stars, Classic Hollywood, Old Hollywood, Hollywood Icons

Military VeteransMilitary ServiceMilitary MenFamous VeteransBrian KeithHollywood StarsClassic HollywoodOld HollywoodHollywood Icons

Actor Brian Keith served in the Marine Corps as a rear gunner in an SBD Douglas Dauntless dive bomber during missions against the Japanese naval base at Rabaul during World War II.

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Spencer Bonaventure Tracy (April 5, 1900 – June 10, 1967) was an American actor. Tracy enlisted in the United States Navy when he turned 18. He was sent to the Naval Training Station in North Chicago, where he was still a student when World War I came to an end. He achieved the rank of seaman second class, but never went to sea and was discharged in February 1919. Hollywood Stars, Classic Hollywood, Old Hollywood, Military Veterans, Military Service, Famous Veterans, People Of Interest, Celebrities Then And Now, Famous People

Hollywood StarsClassic HollywoodOld HollywoodMilitary VeteransMilitary ServiceFamous VeteransPeople Of InterestCelebrities Then And NowFamous People

Spencer Bonaventure Tracy (April 5, 1900 – June 10, 1967) was an American actor. Tracy enlisted in the United States Navy when he turned 18. He was sent to the Naval Training Station in North Chicago, where he was still a student when World War I came to an end. He achieved the rank of seaman second class, but never went to sea and was discharged in February 1919.

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Jack Lord-Army Corp of Engineers then a Commissioned Officer in US Merchant Marines, Coast Guard (Actor) Military Veterans, Military Men, Military Service, Military History, Us Coast Guard, Coast Guard Academy, Famous Veterans, American Soldiers, American Veterans

Military VeteransMilitary MenMilitary ServiceMilitary HistoryUs Coast GuardCoast Guard AcademyFamous VeteransAmerican SoldiersAmerican Veterans

Jack Lord-Army Corp of Engineers then a Commissioned Officer in US Merchant Marines, Coast Guard (Actor)

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Regis Francis Xavier Philbin (born August 25, 1931) is an American media personality, actor and singer, known for hosting talk and game shows. He served in the United States Navy as a supply officer. Military Veterans, Military Service, Military Men, Military History, Famous Veterans, Joining The Military, Celebrities Then And Now, Real Hero, Support Our Troops

Military Veterans

Military History

Famous Veterans

Joining The Military

Celebrities Then And Now

Real Hero

Support Our Troops

Regis Francis Xavier Philbin (born August is an American media personality, actor and singer, known for hosting talk and game shows. He served in the United States Navy as a supply officer.

David Buckle

Amelie - French movies. What one can say about them? The story, the acts, the MUSIC. All and all takes you to a journey, you don't know where did that 2 hours of your life go and that is the miracle of the Cinema. Movie Shots, Moving Pictures, Film Stills, Cinematography, Destin, Audrey Tautou, French Movies, Film Inspiration, Movie Tv

Savoy Truffle

Movie Shots

Moving Pictures

Film Stills


Audrey Tautou

French Movies

Film Inspiratio

Audrey Tautou in “Amelie” http://www.pinterest.com/davejbuc3

George Reeves-Army-1943-Army Air Forces First Motion Picture Unit where he made training films.(Actor) Military Veterans, Military Service, Military Men, Military History, George Reeves, Famous Veterans, Hollywood Actor, Hollywood Stars, Classic Hollywood

Military Veterans

Military ServiceMilitary MenMilitary HistoryGeorge ReevesFamous VeteransHollywood ActorHollywood StarsClassic Hollywood

II, Actor George Reeves, Army Air Forces First Motion Picture Unit where he made training films.

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Bob Dole-Army-1942-48-WW2-10th Mountain Division-Bronze Star, 2 Purple Hearts (Kansas Senator, Senate Majority Leader) Military Veterans, Military Service, Military Men, Military History, Famous Veterans, Senate Majority, Purple Hearts, Support Our Troops, Barbers

Military VeteransMilitary ServiceMilitary MenMilitary HistoryFamous VeteransSenate MajorityPurple HeartsSupport Our TroopsBarbers

Bob Dole-Army-1942-48-WW2-10th Mountain Division-Bronze Star, 2 Purple Hearts (Kansas Senator, Senate Majority Leader)

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

The best way to deal with well-meaning friends trying to “fix” you - advice from the book of job. #bible #chronic illness #invisibleillness #spoonies #support Precious Children, Beautiful Children, Beautiful Babies, Beautiful Stories, Church Memes, Church Humor, Church Signs, Baby Pictures, Cute Pictures

Precious ChildrenBeautiful ChildrenBeautiful BabiesBeautiful StoriesChurch MemesChurch HumorChurch SignsBaby PicturesCute Pictures

Caught Being Godly: Cute Pictures of Babies Praying

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Richard Long (December 17, 1927 – December 21, 1974) was an American actor. Long served in the United States Army during the Korean War. Military Service, Military Veterans, American Soldiers, American Actors, Old Movie Stars, Famous Men, Famous Faces, Hollywood Stars, Classic Hollywood

Military ServiceMilitary VeteransAmerican SoldiersAmerican ActorsOld Movie StarsFamous MenFamous FacesHollywood StarsClassic Hollywood

Richard Long (December 1927 – December was an American actor. Long served in the United States Army during the Korean War.I had the wonderful chance to see him on stage in Hollywood.in Under the Yum Yum Tree.

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Philip Ahn-Army-WW2-Special Services (Actor) Military Veterans, Military Service, Military Men, Military History, Famous Veterans, Hollywood Actor, Hollywood Stars, People Of Interest, Famous Celebrities

Military VeteransMilitary ServiceMilitary MenMilitary HistoryFamous VeteransHollywood ActorHollywood StarsPeople Of InterestFamous Celebrities

Philip Services (Actor) He probably had a hard time with his fellow soldiers with his nationalit

Charles Bronson-Army Air Force-WW2-1943-45-Aircraft gunner/Superfortress crewman/flew on 25 missions on B-29 bombers, Purple Heart(Actor) Actor Charles Bronson, Military Veterans, Military Service, Military Men, Military History, Celebrities Then And Now, Famous Celebrities, Hollywood Actor, Hollywood Glamour

Actor Charles Bronson

Military Service

Military Men

Military History

Celebrities Then And Now

Famous Celebritiesl

Wesley "Wes" Studi (born December 17, 1947) is an American actor of Cherokee ancestry, who has earned notability for his portrayal of Native Americans in film. A Vietnam veteran, musician, author, and activist, Wes is also a stone carver and creates amazing art. He taught classes in the Cherokee language and syllabary (writing system), and helped found a Cherokee-language newspaper. Wes Studi, Famous Veterans, Cherokee Language, American Soldiers, American Actors, American History, Cherokee Nation, Hal Moore, Indian People

Wes Studi

Famous Veteran

American Soldiers

American Actors

American History

Cherokee Nation

Hal Moore

Indian People

Wesley “Wes” Studi (born December is an American actor of Cherokee

William Talman-Army-WW2-Major-served 30 months in the Pacific-(Actor) He was the prosecuting attorney on Perry Mason. Hollywood Actor, Hollywood Stars, Military Veterans, Military Service, Military History, Ww2 History, Perry Mason, Joining The Military, Famous Veterans

Hollywood ActorHollywood StarsMilitary VeteransMilitary ServiceMilitary HistoryWw2 HistoryPerry MasonJoining The MilitaryFamous Veterans

William Talman – served 30 months in the Pacific. He was the prosecuting attorney on Perry Mason.

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Elisha Vanslyck Cook, Jr. (December 26, 1903 – May 18, 1995) was an American character actor. Enlisted in U.S. Army on 15 August 1942 and served for four years. Military Veterans, Military Service, Military Men, Military History, Famous Veterans, Joining The Military, Actors Male, December 26, Classic Movie Stars

Military Veterans

Military Service

Military Men

Military History

Famous Veterans

Joining The Military

Actors Male

December 26

Classic Movie Stars

Ty Hardin, born Orison Whipple Hungerford, Jr., (born January 1, 1930), is a former American actor. He served in the U.S. Army during the Korean War. He was commissioned after attending Officer Candidate School, and became a pilot of Forward Observer O-1 Bird Dog liaison aircraft. Military Veterans, Military Service, Military Men, Famous Veterans, Hollywood Actor, Hollywood Stars, Classic Hollywood, January 1, Tv Actors

Military Veterans

Military Service

Military Men

Famous Veterans

Classic Hollywood

January 1

Tv Actors

Ty Hardin, b: Orison Whipple Hungerford, Jr. Army Korean War -commissioned after attending Officer Candidate School, and became a pilot of Forward Observer Bird Dog liaison aircraft.

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Philip Carey-Marines-wounded-served on USS Franklin-WW2. Also served in Korean War. (Actor) Famous Marines, Military Veterans, Military Service, Famous Veterans, Joining The Military, Support Our Troops, American Soldiers, Korean War, Famous Men

Famous MarinesMilitary VeteransMilitary ServiceFamous VeteransJoining The MilitarySupport Our TroopsAmerican SoldiersKorean WarFamous Men

Philip Carey-Marines-wounded-served on USS Also served in Korean War. (Actor)Granny Goose for Lays Potato Chips, and Asa Buchanan on One Life to Live.

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

english9149.jpg Gun Quotes, Wise Quotes, Political Views, Political Memes, Political Equality, Gun Control, Control Freaks, Submachine Gun, Random Stuff

Gun QuotesWise QuotesPolitical ViewsPolitical MemesPolitical EqualityGun ControlControl FreaksSubmachine GunRandom Stuff

In any Englishman could own any modern weapon, yet crime was so rare that Bobbies seldom carried firearms. – Now, UK residents are disarmed, yet violent crime is so common that the cops carry submachine guns.

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Roy Richard Scheider (November 10, 1932 – February 10, 2008) was an American actor and amateur boxer. He served three years as an officer in the Air Force. Roy Scheider, Famous Men, Famous Celebrities, Famous Faces, Military Veterans, Military Service, Famous Veterans, American Soldiers, American Actors

Roy ScheiderFamous MenFamous CelebritiesFamous FacesMilitary VeteransMilitary ServiceFamous VeteransAmerican SoldiersAmerican Actors

Roy Richard Scheider (November 1932 – February was an American actor and amateur boxer. He served three years as an officer in the Air Force.

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Colin Powell-Army-1958-93-General-Vietnam, Panama, Persian Gulf War-34 awards, 7 foreign awards, 10 badges (65th Secretary of State, Joint Chiefs of Staff, National Security Advisor) Military Personnel, Military Veterans, Military Service, Military Men, Military History, Famous Veterans, Chief Of Staff, American Soldiers, Famous Men

Military PersonnelMilitary VeteransMilitary ServiceMilitary MenMilitary HistoryFamous VeteransChief Of StaffAmerican SoldiersFamous Men

Colin Powell-Army-1958-93-General-Vietnam, Panama, Persian Gulf War-34 awards, 7 foreign awards, 10 badges (65th Secretary of State, Joint Chiefs of Staff, National Security Advisor)

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Buddy Hackett- Army-WW2 anti-aircraft Buddy Hackett, Military Veterans, Military Service, Famous Veterans, Joining The Military, Comedy Tv, American Soldiers, Famous Men, Us Army

Buddy HackettMilitary VeteransMilitary ServiceFamous VeteransJoining The MilitaryComedy TvAmerican SoldiersFamous MenUs Army

went on to be a very funny comedian.

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Robert Cummings-Army Air Corps-WW2-first official flight instructor-he was taught to fly by his godfather Orville Wright. (Inknscroll)--Always one of my favorite actors (mkc). Military Veterans, Military Service, Military Men, Military History, Famous Veterans, Robert Cummings, Joining The Military, Appris, American Veterans

Military VeteransMilitary ServiceMilitary MenMilitary HistoryFamous VeteransRobert CummingsJoining The MilitaryApprisAmerican Veterans

Robert Cummings — Army Air Corps in – first official flight instructor. He was taught to fly by his godfather Orville Wright.

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Shecky Green-Navy-WW2-served on aircraft carrier Bon Homme Richard based in the Pacific-1944- (Comedian) Military Veterans, Military Service, Military Men, Famous Veterans, Joining The Military, Famous Names, Ww2 History, Real Hero, Aircraft Carrier

Military VeteransMilitary ServiceMilitary MenFamous VeteransJoining The MilitaryFamous NamesWw2 HistoryReal HeroAircraft Carrier

Shecky on aircraft carrier Bon Homme Richard based in the (Comedian)

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Sherman HemsleyHollywood StarsClassic HollywoodFamous MenFamous FacesFamous VeteransMilitary ServiceMilitary VeteransBlack Actors

Sherman Hemsley-Air Force-1954-58 (Actor)

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

MUST READ – 50 Famous Faces in Uniform during WWII

Military ServiceMilitary VeteransHollywood StarsOld HollywoodFamous VeteransJoining The MilitaryDavid NivenColonelFamous People

(Right) David Niven as a Civilian – (Left) David Niven as a SoldierDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Buy marine gps and get free shipping on AliExpress.com

Famous MarinesMilitary ServiceMilitary VeteransHollywood ActorHollywood StarsPeople Of InterestFamous VeteransKorean WarAmerican Soldiers

At joined the Marine Corps, serving 4 years as a field radio operator in Japan and Hawaii and honorably discharged inDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

15 Funny Christian Memes That Will Make You Laugh | Quotes | Fitness | Faith Sincerity, Faith In God, Faith Bible, Christian Humor, Christian Sayings, Christian Faith, Christian Pics, Christian Cartoons, Christian Encouragement

Funny Christian Memes that will make you laugh

SincerityFaith In GodFaith BibleChristian HumorChristian SayingsChristian FaithChristian PicsChristian CartoonsChristian Encouragement

If ya ain’t got Jesus, ya ain’t got nuttin buddyDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Rod Serling-Army-WW2-11Airborne Division fought in New Guinea  Philippines (Screenwriter/Producer/Twilight Zone) Military Veterans, Military Service, Military Men, Military History, Famous Veterans, Hollywood Actor, Hollywood Stars, Real Hero, Support Our Troops

Military VeteransMilitary ServiceMilitary MenMilitary HistoryFamous VeteransHollywood ActorHollywood StarsReal HeroSupport Our Troops

Rod Serling Army WWII, Division fought in New Guinea & Philippines (Screenwriter/Producer/Twilight Zone)

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Outdated Tastes.

Eddie RickenbackerFighter PilotWw2 AircraftMilitary AircraftMedal Of Honor RecipientsPlane And PilotFlying AcePhoto AvionMilitary Personnel

history-museum: “ ace Robert S. Johnson, the first American pilot to surpass Eddie Rickenbacker’s WWI victory total of sits in his plane. Taken between 30 January and 20 FebruaryDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg


Good QuotesFunny QuotesQuotes To Live ByMotivational QuotesLife QuotesInspirational QuotesDaily QuotesKey QuotesSerious Quotes

This set of Funny JokesDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Tennessee Ernie FordMovies PlayingBook PeopleKinds Of PeopleLiver DiseaseWorld War IiWwiiSixteen TonsMovie Stars

He Suffered From Severe Alcoholism. On He Went Into Severe Liver Failure At Dulles Airport After Leaving A State Dinner At The White House. Died 19 Days Later Of Liver Disease

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Sid Caesar-Coast Guard-WW2 Sid Caesar, Military Veterans, Military Service, Famous Veterans, American Exceptionalism, Old Hollywood Stars, Classic Hollywood, Hollywood Glamour, Celebrities Then And Now

Sid CaesarMilitary VeteransMilitary ServiceFamous VeteransAmerican ExceptionalismOld Hollywood StarsClassic HollywoodHollywood GlamourCelebrities Then And Now

Isaac Sidney “Sid” Caesar (September 1922 – February was an American comic actor and writer. In he enlisted in the United States Coast Guard, and served until

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

10 Movies That Will Change Your Life. Scenes from the movie Amélie. #movies Cinematic Photography, Great Movies, Destin, Movie Shots, French Films, Film Inspiration, Moving Pictures, Amelie Haircut, Audrey Tautou

10 Movies That Will Change Your Life

Cinematic PhotographyGreat MoviesDestinMovie ShotsFrench FilmsFilm InspirationMoving PicturesAmelie HaircutAudrey Tautou

Le fabuleux destin d’Amélie Poulain – Jean-Pierre Jeunet (France) – 2011David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

The story of how the future president rescued an aircraft carrier Presidential Libraries, Presidential History, Presidential Trivia, World War I, World History, Military Veterans, Military Service, Military Men, Military History

Fire-Fightin’ Gerry Ford

Presidential LibrariesPresidential HistoryPresidential TriviaWorld War IWorld HistoryMilitary VeteransMilitary ServiceMilitary MenMilitary History

Gerald Ford (July 1913 – December U. President) – United States Naval Reserve Lieutenant Commander World War II combat on USS Monterey, discharged inDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Never Would Have Guessed  WHY MR. ROGERS WORE A SWEATER? Real Hero, American Soldiers, Classic Hollywood, Old Hollywood, Hollywood Stars, Captain Kangaroo, Cat Ballou, Academy Award Winners, Oscar Winners

John Hoxie

Real HeroAmerican SoldiersClassic HollywoodOld HollywoodHollywood StarsCaptain KangarooCat BallouAcademy Award WinnersOscar Winners

Actor Lee Marvin (left) star of “The Dirty Dozen” movie franchise. Bob Keeshan (top right) aka “Captain Kangaroo”, Mr. Rogers (bottom right). All 3 men, certified authentic war heroes. Who would’ve guessed.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Albert Arnold "Al" Gore, Jr. (born March 31, 1948) 45th Vice President of United States. After enlisting in August 1969, he was stationed with the 20th Engineer Brigade in Bien Hoa and was a journalist with The Castle Courier. He received an honorable discharge from the Army in May 1971. Military Insignia, Military Personnel, Military Veterans, Military Service, Famous Veterans, Us History, History Facts, American History, America Civil War

Military InsigniaMilitary PersonnelMilitary VeteransMilitary ServiceFamous VeteransUs HistoryHistory FactsAmerican HistoryAmerica Civil War

Al Vice President of the U.

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

military-memes-funny-funniest-army-tanker-concertina Speed up and simplify the pistol loading process with the RAE Industries Magazine Loader. http://www.amazon.com/shops/raeind Funny Army Memes, Army Humor, Army Jokes, Funny Jokes, Funniest Memes, Funny Military, Army Life, Military Life, Military Style

The 13 funniest military memes of the week

Funny Army MemesArmy HumorArmy JokesFunny JokesFunniest MemesFunny MilitaryArmy LifeMilitary LifeMilitary Style

The 13 funniest military memes of the week – We Are The MightyDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Ben Kuroki World History, World War Ii, Japanese American, Iwo Jima, Historia Universal, United States Army, Interesting History, Us Army, Military History

The Two Wars of Ben Kuroki: New book out about Nebraskan who defied prejudice to become a war hero

World HistoryWorld War IiJapanese AmericanIwo JimaHistoria UniversalUnited States ArmyInteresting HistoryUs ArmyMilitary History

Ben Kuroki – became a dorsal turret gunner on a Liberator. He flew a total of 58 combat missions during World War II, and is the only Japanese-American in the United States Army Air Forces to serve in combat operations in the Pacific theatre

Military VeteransMilitary ServiceFamous VeteransJack PalanceReal HeroAmerican SoldiersWorld HistoryWorld War IiFamous Names

Jack Palance-Army Air in combat and received the Purple Heart and Victory Metal. Had facial reconstruction after bailing out of a burning plane during flight school,

Army LifeArmy MomUs ArmyArmy GirlfriendBoyfriendI Love AmericaGod Bless AmericaNight AmericaAmerica 2

Explore American patriotism with this extensive list of webpages celebrating our heritage. Celebrate America on President’s Day.

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Cher is back on the charts with ‘Woman’s World’

Real HeroWorld War TwoBand Of BrothersBrothers MovieMilitary HistoryWw2 HistoryMilitary HumorMilitary VeteransMilitary Life

Band Of Brothers Hero, Darrell ‘Shifty’ Powers DiesDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

40’s, 50’s, 60’s

Marine LoveDistance LoveLong DistanceHistorical PicturesThe Good Old DaysOur WorldVintage LoveOnce Upon A TimeWwii

Dedicated to the wonderful fashion/makeup/people/culture of the and None of the content posted on here is mine unless otherwise stated. David Buckle

This Day in History: Pearl Harbor prompts George H.W. Bush to enlist

Bush FamilyBarbara BushUs PresidentsAmerican PresidentsAmerican HistoryGreatest PresidentsAmerican PrideNavy VeteranMilitary Veterans

#TDIH (1941) The Japanese attack #PearlHarbor. That surprise attack changed everything, of course, and many Americans rushed to enlist in the #USArmy, #USNavy, or #USMC. One of these men was #GeorgeHWBush. #WWIIDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Buddy Ebsen-Coast Guard-WW21941-46 (Actor): Buddy Ebsen, Military Veterans, Military Service, Joining The Military, Us Coast Guard, Famous Faces, Famous Men, Famous People, Classic Hollywood


Buddy EbsenMilitary VeteransMilitary ServiceJoining The MilitaryUs Coast GuardFamous FacesFamous MenFamous PeopleClassic Hollywood

Buddy Ebsen – Best remembered as “Jed Clampett” on TVs “The Beverly Hillbillies”. Ebsen was accepted and commissioned a Lieutenant in the Coast Guard. He served on the Navy frigate USS Pocatello, a weather ship that served on Station Able.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

George Montgomery(Actor) Army Air Forces WWII Military Veterans, Military Service, Famous Veterans, Famous Names, American Freedom, Famous Celebrities, American Veterans, Hollywood Stars, Old Hollywood

Military VeteransMilitary ServiceFamous VeteransFamous NamesAmerican FreedomFamous CelebritiesAmerican VeteransHollywood StarsOld Hollywood

George Montgomery-Army Air Forces in 1943 (Actor) Married to singer/actress Dinah Shore

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Forrest Tucker-Army-WW2-1942-45-Second Lt. (Actor) Military Veterans, Military Service, Famous Veterans, American Soldiers, Famous Men, Second Lieutenant, Us Army, Arlington Virginia, Hollywood Stars

Home – DC Life Magazine

Military VeteransMilitary ServiceFamous VeteransAmerican SoldiersFamous MenSecond LieutenantUs ArmyArlington VirginiaHollywood Stars

🌟Forrest Tucker / / 67 years old / Lung cancerDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

black history posters | Honor Your African & African American Ancestors Poster Black Power, Booker T, Black History Month, Black Is Beautiful, African Diaspora, Panama, Black People, African American History, Washington


Black History Month Heroes – Booker T. Washington Poster

Black PowerBooker TBlack History MonthBlack Is BeautifulAfrican DiasporaPanamaBlack PeopleAfrican American HistoryWashington

Booker Taliaferro Washington (April 1856 – November was an African-American educator, author, orator, and advisor to presidents of the United States. Between 1890 and Washington was the dominant leader in the African-American community.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

McCain’s Unique Heroism Endowed Him With the Moral Authority to Triumph in Politics North Vietnam, Vietnam War, First Indochina War, Paganism, Crossstitch, Hanoi, Sidney Mccain, Kingston, Cold War

McCain’s Unique Heroism Endowed Him With the Moral Authority to Triumph in Politics — Slate

North VietnamVietnam WarFirst Indochina WarPaganismCrossstitchHanoiSidney MccainKingstonCold War

John McCain recovers from a broken leg after being shot down over Hanoi. The Hanoi Hilton’s most famous captive was probably US Senator John McCain, who was held there from after being shot down over Hanoi and hauled out of a nearby lake by an angry mob.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Donald Trump called the wife of cancer-stricken Sen. John McCain as her husband recovers in hospital (pictured is McCain with wife Cindy Cindy Mccain, We Are Family, Donald Trump, Donald Tramp

President Trump calls wife of cancer-stricken John McCain

Cindy MccainWe Are FamilyDonald TrumpDonald Tramp

The president called Cindy McCain on Friday to offer her his best wishes and ask after her husband, Sen.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Vietnam war veteran who endured one of the longest captivities as a POW Passes Away - http://www.warhistoryonline.com/press-releases/george-robert-hall-vietnam-war-vet-ex-pow-passes-away-february-16.html Vietnam History, Vietnam War, History Online, Passed Away, Colonel, Pilots, American History, War, Us History

Vietnam war veteran who endured one of the longest captivities as a POW Passes Away

Vietnam HistoryVietnam WarHistory OnlinePassed AwayColonelPilotsAmerican HistoryWarUs History

Colonel George Robert Hall, a Vietnam War veteran who endured one of the longest captivities as a POW in American history, has died after he lost hisDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Battle I'll Never Forget Vietnam Vietnam Veterans, Usmc, Military History, World War Ii, War Image, Battle Of Hamburger Hill, North Vietnam, Paratrooper, American History

More Battles I’ll Never Forget

Vietnam VeteransUsmcMilitary HistoryWorld War IiWar ImageBattle Of Hamburger HillNorth VietnamParatrooperAmerican History

May A Shau Valley, South Vietnam. Medics rush an injured paratrooper to an evacuation helicopter during fighting on ‘Hamburger Hill’ in the Vietnam War. Image by © Bettmann/CORBISDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

  Military Humor, Military Gear, Military Veterans, Military Service, Veteran Hats, Vietnam Vets, Us Vets, American Soldiers, Usmc


Military HumorMilitary GearMilitary VeteransMilitary ServiceVeteran HatsVietnam VetsUs VetsAmerican SoldiersUsmc

Gift ideas: Vietnam Veteran caps ,I want this cap.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpgPinterest


Collection by David Buckle  • Last updated 2 weeks ago281  Pins • 154  Followers today is My Consolation Oh Jesus, come and walk with us and let us feel Thy very nearness. I walk with you. Oh! think, My children, not only to guide and comfort you and strengthen and uphold, but for solace and comfort for Myself. When a loving child is by you, is the nearness only that you may provide protection and help for that little one? Rather, too, that in that little child you may find joy and cheer and comfort in its simplicity, its Love, its trust. So, too, is it in your power to comfort and bring joy to My Heart. And I will walk among you, and will be your God, and ye shall be my people.motivatorOther Pins


Long_Layered_Bob_Hairstyle_2011_6.jpg 700×826 pixels Choppy Bob With Bangs, Heavy Bangs, Short Hair With Bangs, Haircuts With Bangs, Bob Haircuts, Blunt Bangs, Blunt Fringe, Long Face Haircuts, Short Choppy Bobs

Choppy Bob With BangsHeavy BangsShort Hair With BangsHaircuts With BangsBob HaircutsBlunt BangsBlunt FringeLong Face HaircutsShort Choppy Bobs

A short brown straight choppy Rock-Chick Womens haircut hairstyle by Jean Louis David

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

now 'm thinkin' dirty stuff...  JK!

now ‘m thinkin’ dirty stuff… JK!

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Soul Surfer: The Bethany Hamilton Story -- Inspiring People, Books and Films Bethany Hamilton, Surf Mar, Soul Surfer, Surf Girls, Beach Girls, Christian Inspiration, Surfs Up, Surfing, Good People

Soul Surfer Bethany Hamilton: Inspirational Christian Athlete

Bethany HamiltonSurf MarSoul SurferSurf GirlsBeach GirlsChristian InspirationSurfs UpSurfingGood People

Soul Surfer: The Bethany Hamilton Story — Inspiring People, Books and Films, champion surfer that lost her arm to a shark, despite that returned to competing.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Other Pins

*curls up in a ball ready to die* awe poor baby :'( I wish I could hug him...can my parents adopt him??!!! He's so cute and I think my heart just broke x Good People, Amazing People, So Sad, Sad Love, Sweet Stories, Cute Stories, Beautiful Stories, Try Not To Cry, Make You Cry

Veteran’s memes to remember (43 Photos)

Good PeopleAmazing PeopleSo SadSad LoveSweet StoriesCute StoriesBeautiful StoriesTry Not To CryMake You Cry

Sad but strong boy<< ok but no you don’t get it. The flag would go to his mother( the mans wife) before it goes to the kid.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

I love this! I assume they meant "Better to live 1 year as a tiger THAN 100 as a sheep" but that's not what they wrote. Incompetence and ignorance lead to such hilarity sometimes. Graffiti Art, Street Art Banksy, Banksy Art, Bansky, Banksy Quotes, Street Art Quotes, Land Art, Poster, Karma

Graffiti ArtStreet Art BanksyBanksy ArtBanskyBanksy QuotesStreet Art QuotesLand ArtPosterKarma

graffiti amsterdam 1 by KARMA

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

The Price Of Freedom. The last 4 are for looting oil. Vietnam War, History Facts, World History, History Weird, Funny History, History Quotes, History Timeline, Interesting History, Interesting Facts

Vietnam WarHistory FactsWorld HistoryHistory WeirdFunny HistoryHistory QuotesHistory TimelineInteresting HistoryInteresting Facts

The Price Of Freedom Remember, when You look out on a Garden of Stone, You see the REAL Cost of War. Something to Remember today, 19 May Armed Forces Day

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

982dde5ad1cf954c984ed33bbc02531f.jpg 620×2,758 pixels Sad Stories, Touching Stories, Angel Stories, I Look To You, All I Ever Wanted, Military Love, Military Memes, Sincerity, God Bless America


Army Retro Print – Army Proud – Retirement Gift – Army Wife – Father’s Day – Veteran Gift – Love My Soldier – Boot Camp Graduation Gift

Sad StoriesTouching StoriesAngel StoriesI Look To YouAll I Ever WantedMilitary LoveMilitary MemesSincerityGod Bless America

I’m crying. This is how our Marines honor each other with respect. How does the president honor them.cutting or stopping their pay. >>> I can’t stop cryingDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

"Jesus Is My Savior!!!!!" by johnnawood ❤ liked on Polyvore featuring interior, interiors, interior design, home, home decor and interior decorating Love The Lord, God Is Good, Gods Love, I Love Him, Lord And Savior, God Jesus, God Loves Me, Jesus Loves Me, Faith In Humanity

Jesus Is My Savior!!!!!

Love The LordGod Is GoodGods LoveI Love HimLord And SaviorGod JesusGod Loves MeJesus Loves MeFaith In Humanity

“Jesus Is My Savior!!!!!” by johnnawood ❤ liked on Polyvore featuring interior, interiors, interior design, home, home decor and interior decoratingDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Do not mess with The Ghost. Military Humor, Military History, Military Tactics, Military Love, Us History, History Facts, American History, American War, Real Hero

25 Soldiers With Killing Sprees Straight Out Of Call Of Duty

Military HumorMilitary HistoryMilitary TacticsMilitary LoveUs HistoryHistory FactsAmerican HistoryAmerican WarReal Hero

Do not mess with The Ghost.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Julia Meikle Ben-Nyah's photo. Bible Scriptures, Christian Living, Christian Life, Christian Quotes, Word Of God, Faith Quotes, Bible Quotes, Battle Ground, Prayer Warrior

Bible ScripturesChristian LivingChristian LifeChristian QuotesWord Of GodFaith QuotesBible QuotesBattle GroundPrayer Warrior

Got nothing you can’t get me with anything – PVC Out in the world is on his terms, here at home is on mine – survive if you can satun. quotes for her

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Hey look!, these small boys know how to salute the troops. But our so called President doesn't. Soldado Universal, Faith In Humanity, We Are The World, Fight For Us, Military Love, Military Salute, Real Hero, American Soldiers, Toy Soldiers

Soldado UniversalFaith In HumanityWe Are The WorldFight For UsMilitary LoveMilitary SaluteReal HeroAmerican SoldiersToy Soldiers

Salute – respect for our military-our troops

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

We're up here at the vacation home in the pines for a long weekend with four dogs (yea, we brought … Ak47, Out Of Touch, Guns And Ammo, Pro Gun, Liberal Logic, Gun Rights, 2nd Amendment, So True, Firearms

Sunday Brickbats, Odds, Ends, And One Funny Thing

Ak47Out Of TouchGuns And AmmoPro GunLiberal LogicGun Rights2nd AmendmentSo TrueFirearms

We’re up here at the vacation home in the pines for a long weekend with four dogs (yea, we brought …David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Do you have a military hero in your family? Search Ancestry records to discover family draft cards, passenger lists, and more. Discover more today. Genealogy Research, Family Genealogy, Genealogy Websites, Ancestry Records, Military Records, Family Matters, Free Family Tree, Family Search, Record Collection

U.S. Military Records Collection

Genealogy ResearchFamily GenealogyGenealogy WebsitesAncestry RecordsMilitary RecordsFamily MattersFree Family TreeFamily SearchRecord Collection

Do you have a military hero in your family? Search Ancestry records to discover family draft cards, passenger lists, and more. Discover more today.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

The Man Who Held Off Six Enemy Tanks and Several Waves of Infantry for an Hour By Firing on Them While Standing Atop a Burning Tank Real Hero, Before Us, Us Army, Armed Forces, Military History, Military Photos, World War Two, World History, Wwii

The Man Who Held Off Six Enemy Tanks and Several Waves of Infantry for an Hour By Firing on Them While Standing Atop a Burning Tank

Real HeroBefore UsUs ArmyArmed ForcesMilitary HistoryMilitary PhotosWorld War TwoWorld HistoryWwii

Audie Murphy received every U. decoration for valor available to Army ground personnel at the time. He earned the Silver Star twice in three days, two Bronze Star Medals, three Purple Hearts, the Distinguished Service Cross, and the Medal of Honor.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

This is a legitimate post from a Christian Facebook page.... Gods Not Dead, Ewan Mcgregor, God Loves Me, Jesus Loves Me, Lord And Savior, God Jesus, Jesus Christ, Christian Memes, Christian Facebook

This is a legitimate post from a Christian Facebook page….

Gods Not DeadEwan McgregorGod Loves MeJesus Loves MeLord And SaviorGod JesusJesus ChristChristian MemesChristian Facebook

Our Lord and savior obi wan kanobiDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Fuck Yeah! #VeteransDay #VeteransThankYou #VeteransHonoring #VeteransAppreciation  #VeteransSupport #VeteransWomen #VeteransHomeless #VeteransArmy #VeteransMilitary #VeteransNavy #VeteransHusband #VeteransRespect Royal Marines, Army Humor, Military Humor, Military Life, Military Art, Military Style, Marine Corps, Military Careers, Military Quotes

Royal MarinesArmy HumorMilitary HumorMilitary LifeMilitary ArtMilitary StyleMarine CorpsMilitary CareersMilitary Quotes

Fuck Yeah! #VeteransDay #VeteransThankYou #VeteransHonoring #VeteransAppreciation #VeteransSupport #VeteransWomen #VeteransHomeless #VeteransArmy #VeteransMilitary #VeteransNavy #VeteransHusband #VeteransRespect

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

"Sam Holiday" ~ WWII Veteran & Navajo Code Talker Historia Universal, Indian Tribes, Native Indian, Native American History, Native American Indians, Code Talker, American Code, Navajo Nation, Usmc

Turquoise Jewelry

Historia UniversalIndian TribesNative IndianNative American HistoryNative American IndiansCode TalkerAmerican CodeNavajo NationUsmc

“Sam Holiday” ~ WWII Veteran & Navajo Code Talker by carleneDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

I want one of these patches.  Social Justice Whiners – Safe Space Bed Wetters Marine Corps, Military Quotes, Military Humor, Military Life, Military Personnel, Military Service, God Bless America, America America, Us Army

Marine CorpsMilitary QuotesMilitary HumorMilitary LifeMilitary PersonnelMilitary ServiceGod Bless AmericaAmerica AmericaUs Army

We All Know There Is No Real Justice In America As Long As These Self Appointed Dictator Socialist Liberals Walk The Planet.

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

#gunrights #liberals #guns #righttobeararms #molonlabe - http://www.sonsoflibertytees.com/patriotblog/gunrights-liberals-guns-righttobeararms-molonlabe/?utm_source=PN&utm_medium=Pinterest&utm_campaign=SNAP%2Bfrom%2BSons+of+Liberty+Tees%3A+A+Liberty+and+Patriot+Blog  #2Ndamendment, #Defendthesecond, #Gun, #Gunrights, #Guns, #Liberals, #Molonlabe, #Righttobeararms, #Secondamendment Leonard Nimoy, Spock, Star Trek, Tbbt, O Drama, Guns And Ammo, Pro Gun, So True, Great Quotes

#gunrights #liberals #guns #righttobeararms #molonlabe

Leonard Nimoy, Spock, Star Trek, Tbbt, O Drama, Guns And Ammo, Pro Gun, So True, Great QuotesDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Sterling Hayden-Marines-Captain-Undercover Agent in OSS-Bronze Star with Arrowhead and Silver Star (Actor) Famous Marines, Military Veterans, Military Service, Famous Veterans, Joining The Military, Hollywood Actor, Hollywood Stars, Navy Reserve, Sterling Hayden

Famous MarinesMilitary VeteransMilitary ServiceFamous VeteransJoining The MilitaryHollywood ActorHollywood StarsNavy ReserveSterling Hayden

Sterling Hayden-Marines-Captain-Undercover Agent in OSS-Bronze Star with Arrowhead and Silver Star (Actor)

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

jesus_teddy Jesus Today, My Jesus, I Love Jesus, Jesus Loves Me, Jesus Freak, Jesus Help, Trust In Jesus, God Help Me, In God We Trust

Five Keys to Discovering Your God-Given Purpose

Jesus TodayMy JesusI Love JesusJesus Loves MeJesus FreakJesus HelpTrust In JesusGod Help MeIn God We Trust

jesus_teddyDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Walter Brennan:WW1:was injured by a gas attack permanently affected his vocal chords.( cannot locate a photo) Military Veterans, Military Service, Military Men, Military History, Hollywood Men, Hollywood Stars, Classic Hollywood, Famous Veterans, Classic Tv

Military VeteransMilitary ServiceMilitary MenMilitary HistoryHollywood MenHollywood StarsClassic HollywoodFamous VeteransClassic Tv

Walter Brennan: In was injured by a gas attack which permanently affected his vocal chords.( cannot locate a photo)

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

devildoggraphix: “Two years ago today, America lost a great warrior and hero. RIP Chris Kyle. You will never be forgotten! “It was my duty to shoot the enemy, and I don’t regret it. My regrets are for... Military Humor, Military Life, Military Quotes, Military History, Usmc Quotes, Military Box, Marine Quotes, Snipers, Chris Kyle Sniper

Major League Infidel

Military HumorMilitary LifeMilitary QuotesMilitary HistoryUsmc QuotesMilitary BoxMarine QuotesSnipersChris Kyle Sniper

devildoggraphix: “Two years ago today, America lost a great warrior and hero. RIP Chris Kyle. You will never be forgotten! “It was my duty to shoot the enemy, and I don’t regret it. My regrets are for…David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Ed McMahon-Marine Reserves-WW2-Korea-1941-66-flight instructor- flew 85 combat missions, earning 6 Air Medals in Korea.Colonel/state commission as Brigadier General Military Veterans, Military Service, Military Men, Military History, Famous Veterans, Marine Reserves, Famous Men, Famous Celebrities, Ed Mcmahon

Military VeteransMilitary ServiceMilitary MenMilitary HistoryFamous VeteransMarine ReservesFamous MenFamous CelebritiesEd Mcmahon

Ed McMahon-Marine instructor- flew 85 combat missions, earning 6 Air Medals in Korea.Colonel/state commission as Brigadier General (TV Host/Announcer/Johnny Carson’s Sidekick)

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Marine Capt. Trevor J. Yurista  Died October 27, 2008 Serving During Operation Enduring Freedom  32, of Pleasant Valley, N.Y.; assigned to the 5th Marine Regiment, 1st Marine Division, I Marine Expeditionary Force, Camp Pendleton, Calif.; died Oct. 27 in Helmand province, Afghanistan, while supporting combat operations. Us Marines, Marines In Combat, Fallen Heroes, Fallen Soldiers, Remember The Fallen, Support Our Troops, American Pride, Real Hero, Marine Corps

Us MarinesMarines In CombatFallen HeroesFallen SoldiersRemember The FallenSupport Our TroopsAmerican PrideReal HeroMarine Corps

Marine Capt. Trevor J. Yurista Died October 27, 2008 Serving During Operation Enduring Freedom 32, of Pleasant Valley, N.Y.; assigned to the 5th Marine Regiment, 1st Marine Division, I Marine Expeditionary Force, Camp Pendleton, Calif.; died Oct. 27 in Helmand province, Afghanistan, while supporting combat operations.

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Phonetic Alphabet/ Morris Code...I have always wanted to learn this. haha! #nerd Phonetisches Alphabet, Alphabet Symbols, Nato Phonetic Alphabet, Sign Language Alphabet, Morse Code Learn, Code Code, Code Art, Elk Hunting, Hunting Guns

Phonetic Alphabet/ Morris have always wanted to learn this. haha! #nerd

Phonetisches AlphabetAlphabet SymbolsNato Phonetic AlphabetSign Language AlphabetMorse Code LearnCode CodeCode ArtElk HuntingHunting Guns

Phonetic Alphabet/ Morris Code…I have always wanted to learn this. Phonetic Alphabet/ Morris Code…I have always wanted to learn this.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

William Holden served in Army Air Services in WWII Old Hollywood Stars, Hollywood Actor, Classic Hollywood, Vintage Hollywood, Military Veterans, Military Service, Military Men, Military History, Military Personnel

Peer Into The Past

Old Hollywood StarsHollywood ActorClassic HollywoodVintage HollywoodMilitary VeteransMilitary ServiceMilitary MenMilitary HistoryMilitary Personnel

William Holden served as a lieutenant in the US Army Air Corps during World War II.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Jackie Cooper-Navy-WW2-South Pacific-active in the reserves for many years, Rank of Captain-Legion of Merit (Actor) Famous Men, Famous Celebrities, Famous People, Hollywood Actor, Hollywood Stars, Military Veterans, Military Service, Joining The Military, American Actors

Famous MenFamous CelebritiesFamous PeopleHollywood ActorHollywood StarsMilitary VeteransMilitary ServiceJoining The MilitaryAmerican Actors

Jackie Cooper, Navy, South Pacific, active in the reserves for many years, Rank of Captain-Legion of Merit.

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Just that Once A Marine, Marine Mom, Us Marine Corps, Marine Corps Humor, Marine Quotes, Usmc Quotes, Military Humor, Military Quotes, Military Life

Once A MarineMarine MomUs Marine CorpsMarine Corps HumorMarine QuotesUsmc QuotesMilitary HumorMilitary QuotesMilitary Life

“Y el 8 día Dios creó los Marines, el diable rugió y dijó.”Oh mierda”

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Military Vets - KNOCK KNOCK! MARINES! Military Humor, Army Humor, Military Life, Military Box, Army Life, Troops, Marine Core, Knock Knock, Funny Army

Log In or Sign Up to View

Military HumorArmy HumorMilitary LifeMilitary BoxArmy LifeTroopsMarine CoreKnock KnockFunny Army

Smilin’ and wavin’David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

RED NECK HAVING FUN Liberal Hypocrisy, Politicians, Liberal Logic, Gun Quotes, Truck Quotes, Liberalism, Pro Gun, 2nd Amendment, Gun Rights


Liberal HypocrisyPoliticiansLiberal LogicGun QuotesTruck QuotesLiberalismPro Gun2nd AmendmentGun Rights

Add murder by scalpel (abortions) to the tune of Almost a million per year in the US!David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Dv “s” s - Google+ Real Life Heros, Memes In Real Life, Reality Of Life, Truth Of Life, True Quotes, Apj Quotes, Motivational Quotes, Inspirational Quotes, Funny Quotes

Real Life HerosMemes In Real LifeReality Of LifeTruth Of LifeTrue QuotesApj QuotesMotivational QuotesInspirational QuotesFunny Quotes

I dont know if this is real or not but it made me tremble.

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Henry Mancini. US Army Air Corps. World War II. Musician Military Veterans, Military Service, Famous Veterans, Henry Mancini, Joining The Military, Armed Forces, Military History, Famous Men, World War Ii

Henry Mancini – Biography

Military VeteransMilitary ServiceFamous VeteransHenry ManciniJoining The MilitaryArmed ForcesMilitary HistoryFamous MenWorld War Ii

Henry Mancini-Army Air Composer of the dreamy “Moon River” and more greatmusic.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

High end, luxury art prints from Comics, Film and more. Limited Editions and hand-signed - these make the most amazing gifts for that discerning geek in your life. Star Trek Characters, Amazing Gifts, Sideshow Collectibles, Star Wars Art, Geek Culture, Asoka Tano, Recommended Reading, Carrie Fisher, Chopsticks

Art Prints

Star Trek CharactersAmazing GiftsSideshow CollectiblesStar Wars ArtGeek CultureAsoka TanoRecommended ReadingCarrie FisherChopsticks

High end, luxury art prints from Comics, Film and more. Limited Editions and hand-signed – these make the most amazing gifts for that discerning geek in your life.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Marine Cpl. James L. Moore Died January 26, 2005 Serving During Operation Iraqi Freedom, 24, of Roseburg, Ore.; assigned to 1st Battalion, 3rd Marine Regiment, 3rd Marine Division, III Marine Expeditionary Force, Marine Corps Base Hawaii; killed Jan. 26 when the CH-53E helicopter in which he was riding crashed near Rutbah, Iraq. Twenty-nine Marines and one sailor also were killed. Marine Corps Bases, Hero's Journey, Real Hero, January 26, Fallen Heroes, Home Of The Brave, American Soldiers, God Bless America, Armed Forces

Marine Corps BasesHero’s JourneyReal HeroJanuary 26Fallen HeroesHome Of The BraveAmerican SoldiersGod Bless AmericaArmed Forces

Heroes journey essay assignment on respect Sep 2013 ·. The Hero’s Journey, writing assignment, ideas from the essay “The Hero’s Journey,” but you are able. Wednesday Homework, The Hero’s Journey.

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Repentance is NOT when you cry. Repentance is when you CHANGE! #Repentance Lord And Savior, True Repentance, Forgiveness In The Bible, Forgiveness Quotes Christian, Christian Quotes, Faith Quotes, Life Quotes Love, Bible Quotes, Biblical Quotes

2:57Lord And SaviorTrue RepentanceForgiveness In The BibleForgiveness Quotes ChristianChristian QuotesFaith QuotesLife Quotes LoveBible QuotesBiblical Quotes

#ChristianQuotes #BibleQuotes

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

What to do about Your Liberal Friends WordPress, Common Sense, Pro Gun, Freedom, Gun Rights, Gun Control, Self Defense, 2nd Amendment, Guns And Ammo

WordPressCommon SensePro GunFreedomGun RightsGun ControlSelf Defense2nd AmendmentGuns And Ammo

History and Statistics Prove That Gun Bans and Gun Control Legislation are Dangerous to Freedom & Liberty.

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

cf67d1c4ff2747bd91dc2d69513c895a.jpg 640×853 pixels Poppies Poem, Veterans Day Poppy, Veterans Day Activities, Memorial Day Activities, Remembrance Day Activities, Holiday Activities, Remembrance Sunday, Remembrance Day Quotes, Thinking Day

Poppies PoemVeterans Day PoppyVeterans Day ActivitiesMemorial Day ActivitiesRemembrance Day ActivitiesHoliday ActivitiesRemembrance SundayRemembrance Day QuotesThinking Day

Memorial Day Poppy & Poem Make them into pins for the kids to wear Supplies: Red Paper Sharpie Scissors Glue Safety Pins Poem: Print on a ribbon?

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

  Marine Corps Memes, Us Marine Corps, Military Jokes, Military Veterans, Military Life, Marines Funny, Us Marines, Usmc Humor, Once A Marine

Marine Corps Memes, Us Marine Corps, Military Jokes, Military Veterans, Military Life, Marines Funny, Us Marines, Usmc Humor, Once A Marine

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Funny Pictures brought to you by LolSnaps. Constant updates of the best funny pictures on the web. I Smile, Make Me Smile, Sincerity, Believe, Look At You, All That Matters, No Me Importa, A Good Man, This Man

Good guy soldier

I SmileMake Me SmileSincerityBelieveLook At YouAll That MattersNo Me ImportaA Good ManThis Man

This man!” It always restores my faith in humanityDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Lex Barker-Army-WW2-rank of Major-he was wounded in action (Actor) Military Veterans, Military Service, Famous Veterans, Joining The Military, Famous Names, Hollywood Actor, Old Hollywood, American Presidents, Acting Career

Military VeteransMilitary ServiceFamous VeteransJoining The MilitaryFamous NamesHollywood ActorOld HollywoodAmerican PresidentsActing Career

Lex of Major-he was wounded in action (Actor)

Bulldog NamesBulldog MascotBulldog PuppiesMarine MomUs Marine CorpsUs MarinesUsmcSemper FidelisWas

The first mascot of the United States marines was an English Bulldog named King Bulwark. kings formal title was dropped at his enlistment in.

The Surprising True History Behind Flag Day

I Love America

God Bless America

Lest We Forget

Always Remember

We Will Never Forget

We Remember

American Pride

American History

American Freedom

Dan Blocker “Hoss Cartright” served US Army in the Infantry Division during WWII also recieved the Purple Heart medal

Bible PicturesBiblical ArtHeart Of JesusGod JesusPictures Of Jesus ChristImage JesusIn Christ AloneJesus Loves YouSon Of God

Jesus is waiting If you’re broken down Jesus is waiting, hey yeah Don’t let y.

SayingsPro GunGun RightsGun ControlSelf DefenseConcealed Carry2nd AmendmentCool GunsAwesome Guns

Everyone is born different We Are The World, In This World, Make Me Happy, Make Me Smile, For King And Country, Just Dream, All That Matters, Funny Pictures, Funny Images

Everyone is born different

We Are The WorldIn This WorldMake Me HappyMake Me SmileFor King And CountryJust DreamAll That MattersFunny PicturesFunny Images

American VeteransAmerican SoldiersFort BelvoirArmy HistoryBlack HistoryProsthetic LegWounded WarriorLife Goes OnHome Of The Brave

For the first time in the Army’s history, a double amputee has taken the reins as garrison commander of a major installation.

Military VeteransMilitary ServiceMilitary RanksMilitary LifeUsmcMarinesBattle Of SaipanFamous VeteransUs Marine Corps

Lee Marvin left school and joined the US Marine Corps as a sniper scout. He was wounded in action at the Battle of Saipan during WWII and was awarded the Purple Heart and discharged at the rank of Private First Class.

Military Quotes, Military Humor, Army Quotes, Army Humor, Military Pictures, Military Life, Bible Quotes, Airborne Army, Army Infantry

Funny MilitaryMilitary HumourArmy HumorMarines FunnyUs MarinesMilitary PoliceArmy FunnyMilitary Salute Female Marines

USMC Inter-Service Humor targeting the Air Force


Marines FunnyUs MarinesMilitary SuitMarine BabyOnce A MarineMarines GirlfriendUs Marine CorpsMarine HumorSupport Our Troops

True life hero… Let people like him be never forgotten

Sweet StoriesCute StoriesAmazing People StoriesReal HeroReal Life HerosGood PeopleFunny PeopleSpecial PeopleHuman Kindness

Bushtec Motorcycle Trailers | Made in the USA

Motorcycle Cargo TrailerPull Behind Motorcycle TrailerMotorcycle CampingMotorcycle GarageTeardrop Trailer PlansDog TrailerCargo Trailer ConversionCafe BikeCargo Trailers

Shop With Purple Mattress Military Discount

Military HomecomingNavy MilitaryMilitary SpouseDoomsday SurvivalUs Army RangersJoining The MilitaryHomecoming PicturesMarines GirlfriendNavy Air Force

Marine Corps HistoryUs Marine CorpsAmerican UniformWw1 SoldiersWwiOnce A MarineMilitary HumorMilitary HistoryUs Marines

“Every Marine a Rifleman” (but not all are

Freedom’s Sisters, Twenty Great African American Women

Underground RailroadAmerican WomenAfrican American HistoryHarriet TubmanJohn TubmanGreat WomenAmazing WomenAmerican Civil WarBlack People

Military MemesFunny MilitaryMarines FunnyMilitary LifeArmy LifeMilitary ServiceMarine Corps HumorUsmc HumorDad Humor

A dependapotomus spotted in the wild . Browse new photos about A dependapotomus spotted in the wild . Most Awesome Funny Photos Everyday!

Wartime Photo of Lee Marvin – American Actor and Grade A Badass

Military Veterans

Military Service

Military Ranks


Famous Veterans

Us Marine Corps

Lee Marvin left school and joined the US Marine Corps as a sniper scout. He was wounded in action at the Battle of Saipan during WWII and was awarded the Purple Heart and discharged at the rank of Private First Class.

Native American History

American Code

Code Talker

Mexico People

Jo Petty

Indian Tribes

Semper Fi

New Mexico

Charles Durning

Charles Bronson

Military Photos

Military History

American War

Famous Faces

Charles Bronson – American Film Actor Charles Bronson enlisted in the US Army Air Forces in 1943 and served as an aerial gunner. In 1945 he was based on Guam as a Superfortress crewman and was awarded a Purple Heart for wounds received during his servic

75 Inspirational Quotes From The World’s Greatest Leaders To Celebrate Black History Month

American History LessonsAfrican American History MonthHistory For KidsBlack History Month QuotesBlack History Month ActivitiesLife Quotes LoveWorld History ClassroomHistory TeachersWordPress

It Doesnt MatterSincerityThis Is Your LifeAll That MattersVerbatimQuotable QuotesMotivational QuotesInspirational QuotesHumorous Quotes

Soul Surfer Bethany Hamilton: Inspirational Christian Athlete

Bethany HamiltonSurf MarSoul SurferSurf GirlsBeach GirlsChristian InspirationSurfs UpSurfingGood People

Military Wife, Army Mom, I Love America, God Bless America, Usa Flag Wallpaper, American Flag Wallpaper, Patriotic Pictures, Marines, Usmc

Choppy Bob With BangsHeavy BangsShort Hair With BangsHaircuts With BangsBob HaircutsBlunt BangsBlunt FringeLong Face HaircutsShort Choppy Bobs

A short brown straight choppy Rock-Chick Womens haircut hairstyle by Jean Louis David


Army Quotes, Military Quotes, Military Humor, Military Life, Military Art, Us Army, Army Infantry, Military Tattoos, Military Veterans

The remains of an American hero were finally flown home from Vietnam this week. His son was the pilot.

Missing In ActionKilled In ActionVietnam VetsSouthwest Airlines

Navajo Code Talkers

Navajo WeavingNavajo RugsCode TalkerNavajo PeopleTaos New MexicoNavajo NationAmerican StoryLand Of EnchantmentMystery Of History

Wolf HybridFennecSpirit AnimalStuffed AnimalsSave WildlifeMundo AnimalFox AnimalFunny AnimalsAnimals And Pets

The Father Archives • Into the Light Adventures %

Touching StoriesSweet StoriesSad StoriesAwesome StoriesFaith In Humanity Restored MilitaryHuman KindnessUsmcGood PeopleStupid People

20 Amazing Quotes About Life

Superb QuotesAmazing People QuotesQuotes About Mean PeopleInspiring People QuotesBest QuotesFavorite QuotesQuotes About Ignorant PeopleTruth Quotes LifeCheap People Quotes

Your Essential QUOTES Collections of All Time

Wisdom QuotesQuotable QuotesConfucius QuotesPositive QuotesMotivational QuotesMe QuotesMessage QuotesLove For Child QuotesFlower Child Quotes

He Was Just 16 But He Became the Most Decorated WWII Soldier

Speak The Truth QuotesTelling The Truth QuotesWise QuotesQuotable QuotesFool QuotesSocrates QuotesFamous QuotesTruth And LesMotivational Quotes

I Like DogsInspirierender TextDog LifeQuote PostersQuotable QuotesMotivational QuotesInspirational QuotesPositive QuotesDecir No

Military WifeMilitary HumorMilitary UniformsNavy UniformsNavy MilitaryMilitary FamiliesMilitary ServiceMilitary QuotesCoast Guard Uniforms

100 Inspirational and Motivational Quotes of All Time! (18)

Be Wise QuotesBeing Smart QuotesQuotes Of WisdomInspirational And Motivational QuotesInspirational ThoughtsWiser QuotesPeople QuotesQuotable QuotesGreat Quotes

10 Inspirational Quotes Of The Day (542)

Wisdom Quotes


Words Quotes

Quotes To Live By

Motivational Quotes

Wise Wordsd


Positive quotes

Military Veterans

Military Service

Military MeMilitary Humor

Lee Ermey spent 11 years in the Marines-Vietnam in 1968 for 14 months-staff Sergeant and medically retired for injuries received. The first Marine to ever be promoted after retirement. He is an actor and advisor on many movies.


Jack Warden

Military Veterans

Military Service

Famous Veterans

Merchant Marine


Real Hero

American SoldiersUs Army

Jack Warden-Navy and member of the Airborne 1920 – American character actoR

Nixon Presidential Library recreates White House gala for 200 Vietnam POWs to mark the 40th anniversary of their release

World History

History Books

American Presidents

American History

American Pride

Senator Mccain

Vietnam War

WALKING WOUNDED: McCain’s torture left him disfigured and permanently disabled. He’s pictured being greeted by then-President Richard Nixon upon his release in 1973

Military VeteransMilitary ServiceFamous VeteransJoining The MilitaryFamous MenFamous FacesJanssenHollywood StarsClassic Hollywood

David Janssen (March 1931 – February was an American film and television actor. He served two years as an enlisted man in the United States Army.

Jesus Name News

Christian JokesChristian Rock BandsChristian SingersChristian MusicChristian LifeJesus ArmySkillet BandJesus Loves MeGod Loves Me

John cooper (skillet) (right) and Toby Mac (left). Just wait until you see Jesus’ army.

Is insulin resistance standing between you and your healthier self?

Great QuotesWise QuotesArt Of War QuotesQuotable QuotesWisdom SayingsMotivational QuotesInsightful QuotesInspirational QuotesQuotes Pics

Any person capable of angering you becomes your aster; he can anger you only when you permit yourself to be disturbed by him.

Anthony HopkinsMilitary VeteransMilitary ServiceFamous VeteransHollywood ActorHollywood StarsClassic HollywoodOld HollywoodClassic Films

Sir Philip Anthony Hopkins (born 31 December is a Welsh actor of film, stage, and television, and a composer and painter. He spent two years in the British Army doing his national service.

American SoldiersMilitary HistoryClassic HollywoodHollywood StarsClassic TvMilitary ServiceMilitary VeteransMilitary MenFamous Veterans

Johnny Carson / U.Navy WWII 1943 on USS Pennsylvania in the Pacific. Communications officer in charge of decoding encrypted messages.

Military ServiceMilitary VeteransMilitary ArtHollywood ActorHollywood StarsClassic HollywoodFamous MenFamous PeopleFamous Faces

Carlos Ray “Chuck” Norris (born March is an American martial artist…

David Buckle https://collactiona.files.wordpress.com/2019/07/0-5.jpg

Military ServiceMilitary VeteransMilitary MenMilitary HistoryJoining The MilitaryAmerican SoldiersAmerican ActorsFamous MarinesSupport Our Troops

Barry Corbin: at 21 he joined the United States Marine Corps, served two years & then returned to college. He was in the Marine Corp Reserve until 1962 as an assistant Browning Automatic Rifleman.

All That MattersFamily MattersPraise GodGodly WomanEncouragement QuotesFaith QuotesMe QuotesBible QuotesQueen Quotes

He will keep them in Perfect Peace whose mind is stayed on Him. Guarding our hearts and minds through Christ Jesus. Amen, every minute, hour, day, week.

Facebook: http://on.fb.me/Y86UBd Google+: http://bit.ly/10l37o8 Twitter: http://bit.ly/Y86TgB #Quotes #Sayings #Inspire #Love #Quote #LoveQuotes #Inspiration #Life #MotivationQuotes #InspirationQuotes #Saying #LifeQuotes #Motivation #Inspirational #Philos

Wisdom QuotesQuotable QuotesQuotes To Live ByLife QuotesTaoism QuotesLao Tzu QuotesLong Distance LoveBien DitVerbatim

Care about what other people think and you will always be their prisoner – Lao TzuDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Military VeteransMilitary ServiceFamous VeteransJoining The MilitaryPeople Of InterestWorld War OneRed CrossMilitary HistoryArmed Forces

Walt Disney the famous Disney movie this is his true story about him. during world war 1 he jointed Red Cross

Military VeteransMilitary ServiceFamous VeteransCelebrities Then And NowYoung CelebritiesJoining The MilitaryVietnam War PhotosFamous MenFamous Faces

Kris Kristofferson-Army-Captain-helicopter pilot, Ranger school-turned down teacher assignment at West Point (Musician)

Military VeteransMilitary ServiceMilitary MenFamous VeteransBrian KeithHollywood StarsClassic HollywoodOld HollywoodHollywood Icons

Actor Brian Keith served in the Marine Corps as a rear gunner in an SBD Douglas Dauntless dive bomber during missions against the Japanese naval base at Rabaul during World War II.

Hollywood StarsClassic HollywoodOld HollywoodMilitary VeteransMilitary ServiceFamous VeteransPeople Of InterestCelebrities Then And NowFamous People

Spencer Bonaventure Tracy (April 5, 1900 – June 10, 1967) was an American actor. Tracy enlisted in the United States Navy when he turned 18. He was sent to the Naval Training Station in North Chicago, where he was still a student when World War I came to an end. He achieved the rank of seaman second class, but never went to sea and was discharged in February 1919.

Military VeteransMilitary MenMilitary ServiceMilitary HistoryUs Coast GuardCoast Guard AcademyFamous VeteransAmerican SoldiersAmerican Veterans

Military VeteransMilitary ServiceMilitary MenMilitary HistoryFamous VeteransJoining The MilitaryCelebrities Then And NowReal HeroSupport Our Troops

Regis Francis Xavier Philbin (born August is an American media personality, actor and singer, known for hosting talk and game shows. He served in the United States Navy as a supply officer.

Savoy Truffle

Movie ShotsMoving PicturesFilm StillsCinematographyDestinAudrey TautouFrench MoviesFilm InspirationMovie Tv

Audrey Tautou in “Amelie”David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Military VeteransMilitary ServiceMilitary MenMilitary HistoryGeorge ReevesFamous VeteransHollywood ActorHollywood StarsClassic Hollywood

II, Actor George Reeves, Army Air Forces First Motion Picture Unit where he made training films.

Military VeteransMilitary ServiceMilitary MenMilitary HistoryFamous VeteransSenate MajorityPurple HeartsSupport Our TroopsBarbers

Bob Dole-Army-1942-48-WW2-10th Mountain Division-Bronze Star, 2 Purple Hearts (Kansas Senator, Senate Majority Leader)

Military ServiceMilitary VeteransAmerican SoldiersAmerican ActorsOld Movie StarsFamous MenFamous FacesHollywood StarsClassic Hollywood

Richard Long (December 1927 – December was an American actor. Long served in the United States Army during the Korean War.I had the wonderful chance to see him on stage in Hollywood.in Under the Yum Yum Tree.

Military VeteransMilitary ServiceMilitary MenMilitary HistoryFamous VeteransHollywood ActorHollywood StarsPeople Of InterestFamous Celebrities

Philip Services (Actor) He probably had a hard time with his fellow soldiers with his nationality.

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Actor Charles BronsonMilitary VeteransMilitary ServiceMilitary MenMilitary HistoryCelebrities Then And NowFamous CelebritiesHollywood ActorHollywood Glamour

Charles Bronson-Army Air gunner/Superfortress crewman/flew on 25 missions on bombers, Purple Heart(Actor)

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Wes StudiFamous VeteransCherokee LanguageAmerican SoldiersAmerican ActorsAmerican HistoryCherokee NationHal MooreIndian People

Wesley “Wes” Studi (born December is an American actor of Cherokee…

Hollywood ActorHollywood StarsMilitary VeteransMilitary ServiceMilitary HistoryWw2 HistoryPerry MasonJoining The MilitaryFamous Veterans

William Talman – served 30 months in the Pacific. He was the prosecuting attorney on Perry Mason.

Military VeteransMilitary ServiceMilitary MenMilitary HistoryFamous VeteransJoining The MilitaryActors MaleDecember 26Classic Movie Stars

(December 1903 – May was an American character actor. Army on 15 August 1942 and served for four years.

Military VeteransMilitary ServiceMilitary MenFamous VeteransHollywood ActorHollywood StarsClassic HollywoodJanuary 1Tv Actors

Ty Hardin, b: Orison Whipple Hungerford, Jr. Army Korean War -commissioned after attending Officer Candidate School, and became a pilot of Forward Observer Bird Dog liaison aircraft.

Famous MarinesMilitary VeteransMilitary ServiceFamous VeteransJoining The MilitarySupport Our TroopsAmerican SoldiersKorean WarFamous Men

Philip Carey-Marines-wounded-served on USS Also served in Korean War. (Actor)Granny Goose for Lays Potato Chips, and Asa Buchanan on One Life to Live.

Gun QuotesWise QuotesPolitical ViewsPolitical MemesPolitical EqualityGun ControlControl FreaksSubmachine GunRandom Stuff

In any Englishman could own any modern weapon, yet crime was so rare that Bobbies seldom carried firearms. – Now, UK residents are disarmed, yet violent crime is so common that the cops carry submachine guns.

Roy ScheiderFamous MenFamous CelebritiesFamous FacesMilitary VeteransMilitary ServiceFamous VeteransAmerican SoldiersAmerican Actors

Roy Richard Scheider (November 1932 – February was an American actor and amateur boxer. He served three years as an officer in the Air Force.

Military PersonnelMilitary VeteransMilitary ServiceMilitary MenMilitary HistoryFamous VeteransChief Of StaffAmerican SoldiersFamous Men

Colin Powell-Army-1958-93-General-Vietnam, Panama, Persian Gulf War-34 awards, 7 foreign awards, 10 badges (65th Secretary of State, Joint Chiefs of Staff, National Security Advisor)

Buddy HackettMilitary VeteransMilitary ServiceFamous VeteransJoining The MilitaryComedy TvAmerican SoldiersFamous MenUs Army

went on to be a very funny comedian.

Military VeteransMilitary ServiceMilitary MenMilitary HistoryFamous VeteransRobert CummingsJoining The MilitaryApprisAmerican Veterans

Robert Cummings — Army Air Corps in – first official flight instructor. He was taught to fly by his godfather Orville Wright.

Military VeteransMilitary ServiceMilitary MenFamous VeteransJoining The MilitaryFamous NamesWw2 HistoryReal HeroAircraft Carrier

Shecky on aircraft carrier Bon Homme Richard based in the (Comedian)

Sherman HemsleyHollywood StarsClassic HollywoodFamous MenFamous FacesFamous VeteransMilitary ServiceMilitary VeteransBlack Actors

Sherman Hemsley-Air Force-1954-58 (Actor)

MUST READ – 50 Famous Faces in Uniform during WWII

Military ServiceMilitary VeteransHollywood StarsOld HollywoodFamous VeteransJoining The MilitaryDavid NivenColonelFamous People

Famous MarinesMilitary ServiceMilitary VeteransHollywood ActorHollywood StarsPeople Of InterestFamous VeteransKorean WarAmerican Soldiers

SincerityFaith In GodFaith BibleChristian HumorChristian SayingsChristian FaithChristian PicsChristian CartoonsChristian Encouragement

Military VeteransMilitary ServiceMilitary MenMilitary HistoryFamous VeteransHollywood ActorHollywood StarsReal HeroSupport Our Troops


Rod Serling Army WWII, Division fought in New Guinea & Philippines (Screenwriter/Producer/Twilight Zone)

Eddie RickenbackerFighter PilotWw2 AircraftMilitary AircraftMedal Of Honor RecipientsPlane And PilotFlying AcePhoto AvionMilitary Personnel


Good QuotesFunny QuotesQuotes To Live ByMotivational QuotesLife QuotesInspirational QuotesDaily QuotesKey QuotesSerious Quotes

This set of Funny JokesDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Tennessee Ernie FordMovies PlayingBook PeopleKinds Of PeopleLiver DiseaseWorld War IiWwiiSixteen TonsMovie Stars

He Suffered From Severe Alcoholism. On He Went Into Severe Liver Failure At Dulles Airport After Leaving A State Dinner At The White House. Died 19 Days Later Of Liver Disease

Sid CaesarMilitary VeteransMilitary ServiceFamous VeteransAmerican ExceptionalismOld Hollywood StarsClassic HollywoodHollywood GlamourCelebrities Then And Now

10 Movies That Will Change Your Life

Cinematic PhotographyGreat MoviesDestinMovie ShotsFrench FilmsFilm InspirationMoving PicturesAmelie HaircutAudrey Tautou

Fire-Fightin’ Gerry Ford

Presidential LibrariesPresidential HistoryPresidential TriviaWorld War IWorld HistoryMilitary VeteransMilitary ServiceMilitary MenMilitary History

Gerald Ford (July 1913 – December U. President) – United States Naval Reserve Lieutenant Commander World War II combat on USS Monterey, discharged in

John Hoxie

Real HeroAmerican SoldiersClassic HollywoodOld HollywoodHollywood StarsCaptain KangarooCat BallouAcademy Award WinnersOscar Winners

Actor Lee Marvin (left) star of “The Dirty Dozen” movie franchise. Bob Keeshan (top right) aka “Captain Kangaroo”, Mr. Rogers (bottom right). All 3 men, certified authentic war heroes. Who would’ve guessed.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Albert Arnold "Al" Gore, Jr. (born March 31, 1948) 45th Vice President of United States. After enlisting in August 1969, he was stationed with the 20th Engineer Brigade in Bien Hoa and was a journalist with The Castle Courier. He received an honorable discharge from the Army in May 1971. Military Insignia, Military Personnel, Military Veterans, Military Service, Famous Veterans, Us History, History Facts, American History, America Civil War

Military InsigniaMilitary PersonnelMilitary VeteransMilitary ServiceFamous VeteransUs HistoryHistory FactsAmerican HistoryAmerica Civil War

Al Vice President of the U.

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

military-memes-funny-funniest-army-tanker-concertina Speed up and simplify the pistol loading process with the RAE Industries Magazine Loader. http://www.amazon.com/shops/raeind Funny Army Memes, Army Humor, Army Jokes, Funny Jokes, Funniest Memes, Funny Military, Army Life, Military Life, Military Style

The 13 funniest military memes of the week

Funny Army MemesArmy HumorArmy JokesFunny JokesFunniest MemesFunny MilitaryArmy LifeMilitary LifeMilitary Style

The 13 funniest military memes of the week – We Are The MightyDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Ben Kuroki World History, World War Ii, Japanese American, Iwo Jima, Historia Universal, United States Army, Interesting History, Us Army, Military History

The Two Wars of Ben Kuroki: New book out about Nebraskan who defied prejudice to become a war hero

World HistoryWorld War IiJapanese AmericanIwo JimaHistoria UniversalUnited States ArmyInteresting HistoryUs ArmyMilitary History

Ben Kuroki – became a dorsal turret gunner on a Liberator. He flew a total of 58 combat missions during World War II, and is the only Japanese-American in the United States Army Air Forces to serve in combat operations in the Pacific theaterDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Jack Palance Military Veterans, Military Service, Famous Veterans, Jack Palance, Real Hero, American Soldiers, World History, World War Ii, Famous Names

Military VeteransMilitary ServiceFamous VeteransJack PalanceReal HeroAmerican SoldiersWorld HistoryWorld War IiFamous Names

Jack Palance-Army Air in combat and received the Purple Heart and Victory Metal. Had facial reconstruction after bailing out of a burning plane during flight school,

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Good Morning   Some people wake up, stretch and enjoy Freedom  Some people wake up, stretch and defend it Army Life, Army Mom, Us Army, Army Girlfriend, Boyfriend, I Love America, God Bless America, Night America, America 2

Army LifeArmy MomUs ArmyArmy GirlfriendBoyfriendI Love AmericaGod Bless AmericaNight AmericaAmerica 2

Explore American patriotism with this extensive list of webpages celebrating our heritage. Celebrate America on President’s Day.

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Darrell "Shifty" Powers Real Hero, World War Two, Band Of Brothers, Brothers Movie, Military History, Ww2 History, Military Humor, Military Veterans, Military Life

Cher is back on the charts with ‘Woman’s World’

Real HeroWorld War TwoBand Of BrothersBrothers MovieMilitary HistoryWw2 HistoryMilitary HumorMilitary VeteransMilitary Life

Band Of Brothers Hero, Darrell ‘Shifty’ Powers DiesDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

WW II couple. Marine Love, Distance Love, Long Distance, Historical Pictures, The Good Old Days, Our World, Vintage Love, Once Upon A Time, Wwii

40’s, 50’s, 60’s

Marine LoveDistance LoveLong DistanceHistorical PicturesThe Good Old DaysOur WorldVintage LoveOnce Upon A TimeWwii

Dedicated to the wonderful fashion/makeup/people/culture of the and None of the content posted on here is mine unless otherwise stated.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

#TDIH (1941) The Japanese attack #PearlHarbor. That surprise attack changed everything, of course, and many Americans rushed to enlist in the #USArmy, #USNavy, or #USMC. One of these men was #GeorgeHWBush. #WWII Bush Family, Barbara Bush, Us Presidents, American Presidents, American History, Greatest Presidents, American Pride, Navy Veteran, Military Veterans

This Day in History: Pearl Harbor prompts George H.W. Bush to enlist

Bush FamilyBarbara BushUs PresidentsAmerican PresidentsAmerican HistoryGreatest PresidentsAmerican PrideNavy VeteranMilitary Veterans

#TDIH (1941) The Japanese attack #PearlHarbor. That surprise attack changed everything, of course, and many Americans rushed to enlist in the #USArmy, #USNavy, or #USMC. One of these men was #GeorgeHWBush. #WWIIDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Buddy Ebsen-Coast Guard-WW21941-46 (Actor): Buddy Ebsen, Military Veterans, Military Service, Joining The Military, Us Coast Guard, Famous Faces, Famous Men, Famous People, Classic Hollywood


Buddy EbsenMilitary VeteransMilitary ServiceJoining The MilitaryUs Coast GuardFamous FacesFamous MenFamous PeopleClassic Hollywood

Buddy Ebsen – Best remembered as “Jed Clampett” on TVs “The Beverly Hillbillies”. Ebsen was accepted and commissioned a Lieutenant in the Coast Guard. He served on the Navy frigate USS Pocatello, a weather ship that served on Station Able.David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

George Montgomery(Actor) Army Air Forces WWII Military Veterans, Military Service, Famous Veterans, Famous Names, American Freedom, Famous Celebrities, American Veterans, Hollywood Stars, Old Hollywood

Military VeteransMilitary ServiceFamous VeteransFamous NamesAmerican FreedomFamous CelebritiesAmerican VeteransHollywood StarsOld Hollywood

George Montgomery-Army Air Forces in 1943 (Actor) Married to singer/actress Dinah Shore

David Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

Forrest Tucker-Army-WW2-1942-45-Second Lt. (Actor) Military Veterans, Military Service, Famous Veterans, American Soldiers, Famous Men, Second Lieutenant, Us Army, Arlington Virginia, Hollywood Stars

Home – DC Life Magazine

Military VeteransMilitary ServiceFamous VeteransAmerican SoldiersFamous MenSecond LieutenantUs ArmyArlington VirginiaHollywood Stars

🌟Forrest Tucker / / 67 years old / Lung cancerDavid Bucklehttps://collactiona.files.wordpress.com/2019/07/0-5.jpg

black history posters | Honor Your African & African American Ancestors Poster Black Power, Booker T, Black History Month, Black Is Beautiful, African Diaspora, Panama, Black People, African American History, Washington


Black History Month Heroes – Booker T. Washington Poster

Black Power

Booker T

Black History Month

Black Is Beautiful

African Diaspora


Black People

African American History



McCain’s Unique Heroism Endowed Him With the Moral Authority to Triumph in Politics — Slate

North Vietnam

Vietnam War




Sidney Mccain


Cold War

John McCain recovers from a broken leg after being shot down over Hanoi. The Hanoi Hilton’s most famous captive was probably US Senator John McCain, who was held there from after being shot down over Hanoi and hauled out of a nearby lake by an angry mob.

President Trump calls wife of cancer-stricken John McCain

Cindy Mccain

We Are Family

Donald Tramp

The president called Cindy McCain on Friday to offer her his best wishes and ask after her husband, Sen.

Vietnam war veteran who endured one of the longest captivities as a POW Passes Away

Vietnam HistoryVietnam WarHistory OnlinePassed AwayColonelPilotsAmerican HistoryWarUs History

Colonel George Robert Hall, a Vietnam War veteran who endured one of the longest captivities as a POW in American history, has died after he lost his

Battle I'll Never Forget Vietnam Vietnam Veterans, Usmc, Military History, World War Ii, War Image, Battle Of Hamburger Hill, North Vietnam, Paratrooper, American History

More Battles I’ll Never Forget

Vietnam VeteransUsmcMilitary HistoryWorld War IiWar ImageBattle Of Hamburger HillNorth VietnamParatrooperAmerican History

May A Shau Valley, South Vietnam. Medics rush an injured paratrooper to an evacuation helicopter during fighting on ‘Hamburger Hill’ in the Vietnam War. Image by © Bettmann/CORBIS


Military HumorMilitary GearMilitary VeteransMilitary ServiceVeteran HatsVietnam VetsUs VetsAmerican SoldiersUsmc

Gift ideas: Vietnam Veteran caps ,I want this cap.



A Dose of Inspiration ~ Be Inspired! to do, not only talk

he died protecting us.

ACTION, NOT words. https://onlizinenet.blog/2019/10/28/our-military-still-paying-the-price

https://twitter.com/i/moments/1203346332750143489 tribute 2 fallen

and how

Each day you can journey from your Alpha (it begins with you) to your Omega, which in the teachings of Pierre Teilhard de Chardin, is the point within each of us where our inner spiritual nature meets our outer worldly nature. It is with this thought I bring to you daily dose of affirmations for […]

Daily Dose of Inspiration — Be Inspired..!!

a fallen American, he did, so we all can avoid such occurrence personal like…


this just considered:

to be suggested, not forced, yet disabled from seeing amusing images all in

computerized, falsified. 1’s and 0’s, conversion to digital entity, from the living ‘n’

breathing human; well as got something to say, even if it is. a sort of banter

that ‘control’ considers rebellious, my mind creates incidences; a cause and effect

stream of literary shouting, only this time not all capitalized, and that, does

feel like the lower case letters to be much more emotive, not so rigid and all ‘so to

be’ regarded more… much more , but that’s a tangent not to be developed.


something that is evolving as we type… http://www.carolinatheatreclt.org/theatre/history





creation is crying out, there IS a God.

‘m no better than you








Discussion on The https://www.pinterest.com/davejbuc3 don’t look

Poll Finds More Young Americans Think Well Of Socialism, Communism

David 2 days ago https://en.gravatar.com/davidb48https://www.youtube.com/watch?v=M_Q6ZSzV8iQ



well, not going to soil this immediate mind by reading other’s additions,

youth will be the future; IF they understand that said future is their future
they might consider reality, not the boob-tube’s media folly. the effort to

change the current power that is will only arrive with inexperienced vote.

young opinions are marked with an almost deadly self opinion. think of it
from those who have been there before in a not so similar situation, but it
just doesn’t matter. socialism generates sadness, more as it morphs into
communism. socialism is communism with Christmas lights. it may seem
so innocent, presents in view, but nothing, but nothing’s free on this globe.

the piper WILL be paid. think of the things you will lose, with that free

ride they like to voice to the uninformed, are full of energy for a personal
assumed gift. that gift will cost in the future, maybe not in the short sight,
but believe it. it will come from the rear. biting every liberty and freedom you
think will last forever. hint: nothing lasts forever; barring the Word of God. dig it.

let us not remember, and spout out, history. it’s bunk, nice to recall, but not to return. DO NOW.
actions, not words…

the future is owned by the youth of America. said group of citizens be seeing all
the joys you experience now. that free ride will cost you young adults your future. Edit View in discussion Discussion on About Jesus.net 7 comments

God is TRULY worthy of praise!

David 2 days ago Edit View in discussion David 2 days ago

Gentle Touch

Jose San Martin 9:01 PM (20 minutes ago)

to HGT

Daily Lesson

Consider the advice of your elders not
because they are always right but because
of the wisdom they have gleaned from
being wrong…Native American quote

As you look back on your younger years
the number of times you thought your
parents were wrong are now echos that
you hear when you try to tell your
children what to do. Remember, you are
never too old to learn from someone even
a few days older than you and never so
old you can not teach someone a few
days younger. Edit View in discussion David 6 days ago


worldwide posting, no cost, only encouragement would be realizing how
late it really is to NOT believe. you will not lose if “TO” is your decision…

https://en.gravatar.com/dav…https://wordpress.com/view/… Edit View in discussion David 7 days ago

glad to be back ya’ll! https://jesus.net
Edit View in discussion David 5 months ago

https://dailyps.com/conside… as a doornail. View in discussion Discussion on newsCafe 41 comments


David 6 days ago Pending

Trump 2020 – otherwise we’re headed for socialism;
which IS communism with out Christmas decortuion Discussion on About Jesus.net 3 comments

Watch The Case For Christ

David 7 days ago

https://the3rdonlive.wordpress.com/ Edit View in discussion Discussion on Brighteon.com 1 comments

Govt Health Care Is About To Implode – Brighteon

David 5 months ago

the views and the opinions expressed in

https://collactiona.live/o9d DO represent

the views/ideas/beliefs of David Buckle… View in discussion Discussion on About Jesus.net 4 comments

Do you want to please God?

DavidCharlotte Christine Roman 5 months ago as am i View in discussion Discussion on Dailyps 8 comments

Consider Yourself Dead

David 5 months ago

https://wordpress.com/read/… View in discussion


what will happen?

Make the most of every opportunity for doing good in these evil days. — Ephesians 5:16

We must buy up the opportunities we have before the night comes. This is the day of opportunity. Our church took a survey of two thousand women in our community to find out what they were thinking, and how our women’s ministry could best meet their needs. Out of all of those interviewed, only a handful of women were hostile or refused to talk with us. We need to buy up the opportunities with the many who are interested and searching.

Colossians 4:5 tells us to “live wisely among those who are not Christians, and make the most of every opportunity.” Paul goes on to explain that in this wise walk, our speech must be salty (there will be a tang to it) so that we may know how to answer every person. Making the most of every opportunity means cultivating the “know-how” of argument and debate. Making the most of every opportunity means that by our very lifestyle, we will engender some questions from others.

Once in a train full of rowdy, drunken football fans, a young Christian was sitting quietly, reading. An old gentleman, observing first the drunks and then the young man, said to him, “You seem to have found the secret to life—do you want to share it?” Our young friend lost no time “making the most of the opportunity”!

We must ask God for a great sense of urgency so that we can make the most of every opportunity to serve and share him.

For further study: Ephesians 5:15-20

He does the picking and choosing; maybe ones character and behavior matter.


when will we ACT not talk









“God Has No Rival!”

  1. posted on Daily Encouragement:
  2. God Has No Rival!”
  3. A view looking up Kraybill Church Road from our driveway.   “God Has No Rival!”
  4. www.youtube.com/watch?v=0kpJp2W6i9Y



  1. Stephen C. Weber“Changes, Challenges And Choices”
  2. Message summary: Today we will consider changes, challenges and choices. Listen to this message on your audio player.
  3. “Choose for yourselves this day whom you will serve, whether the gods your ancestors served beyond the Euphrates, or the gods of the Amorites, in whose land you are Which of course elicits a number of responses. Bunny then says,
  4. “Today is the day God has given me the opportunity to tell you that Jesus loves you!”Yesterday he went along with us for our chaplain visits, especially looking for opportunities to minister to truck drivers. Our first company yesterday receives many containers from a port and Bunny is seeking ways to share God’s love with these drivers.At this company we have the opportunity to share a brief devotional message early each Tuesday morning so yesterday I asked Bunny to share. He shared that we all have changes, challenges and choices in life which prompted today’s study.Some 3,400 years ago Joshua gave his final challenge to the children of Israel. He had lived his life in steadfast commitment to God. He’s first mentioned in Scripture as the trusted commander of Moses’ army shortly after they crossed the Red Sea during the Exodus. He, along with Caleb, was one of only two spies to bring back a faith-filled report that essentially said, “With God’s help we can do it!”Joshua had faithfully served under Moses during the 40-year period in the wilderness and had led God’s people in the conquest for some 25 years. He’s now 110 years old and musters enough strength for a final challenge to faith and commitment that rings through the ages.The people were experiencing three C’s that people all though the ages have dealt with. 
  5. 1) Changes – The Israelites had entered the promised land under Joshua’s leadership but now were about to experience a change. Things weren’t going to stay the same; there would soon be new leadership. We go through many changes throughout the course of our lives; some major, even life-transforming, others smaller. Most of us really don’t know what change we will encounter today, but great assurance can fill our hearts when we remember that God said “I the Lord do not change” (Malachi 3:6). He is a steady presence in our life, the anchor for our faith when all other ground is sinking sand. Thomas Chisolm reminds us that we can rely on our unchanging God in the hymn classic, Great Is Thy Faithfulness: “Thou changest not, Thy compassions, they fail not. As Thou hast been Thou forever wilt be.” 
  6. 2) Challenges – Changes often bring on challenges. Although the people had entered the promised land many challenges lay ahead for them. Just keep reading and you’ll see one challenge after the other! In our lives changes usually bring challenges as well and just like the Israelites we will receive blessing when we obey God.
  7. Choices – Usually there are choices we must make as a result of changes and challenges, and that makes life hard. Today we will all make many, many choices. Life is just full of choices and decision-making, from tiny daily choices such as what brand of soap to purchase or what to eat for dinner to major, life altering decisions such as our choice for a mate or career. Many choices do not have moral consequences but many others are a choice between right and wrong. “There is a way that seems right to a man, but in the end it leads to death” (Proverbs 14:12). However there is one fundamental choice we all share, based upon today’s portion of Scripture in the Old Testament. Joshua set the fundamental choice clearly before the people with these words, “Choose for yourselves this day whom you will serve”. In the context of Joshua’s challenge their fundamental choice was between serving the one true God and “the gods your ancestors served beyond the Euphrates, or the gods of the Amorites, in whose land you are living.”In a broader sense the choice now and for every generation is whether we serve the one true God or “the god of this world” (2 Corinthians 4:4). Even those who practice the faith of atheism are essentially serving the god of this world. People then and now have this fundamental choice, for the one true God does not force people to love and serve Him.Joshua sets a great example for the people of his time and through all subsequent ages, including our own. Let us proclaim this day, “As for me and my house, we will serve the Lord!”
  8. Be encouraged today,
  9. Daily prayer:  Father, You have drawn us with an everlasting love; You show us Your loving kindness day after day. Your bountiful provision gives to us material, physical and spiritual blessings that only a caring heavenly Father can give. But even though our cup overflows with Your goodness we face changes and challenges amidst our blessing. As we deal with the inevitable changes and the subsequent challenges that follow help us to make the life defining choice, like Joshua, and declare to all who will hear,
  10. “As for me and my house we will serve the Lord.” 





“People are always blaming
their circumstances
for what they are
I do not believe in
The people who get on in
in this world are the people
who get up and look for the
circumstances they wan,
and, if they can’t find them,
make them.”

George Bernard Shaw (1865-1950)


Yea, what he said

could be, should be, so it is now :.)
saved to be secure in life, know there is more than meets the eye
https://www.youtube.com/user/Godiswithusfull TRUST GOD ALWAYS

% God Does Not Want You To Try Harder, He Wants You To Trust Him %


invitations are not only said

To those who know Me not, there is in Me nothing to appeal to them, or to attract them.

Those who know Me there is nothing more to be desired.

“No beauty they could desire Him.”

Oh! My children, draw very near to Me. See Me as I really am,

that ever you may have the Joy of finding in Me all you could desire.

The fulfillment of all you could desire in Master, Lord, or Friend.

such is the this case here, my friend, ‘m not upset…

All Are called… few RSVP, huh?



October 3 — Blessed Assurance
And the work of righteousness shall be peace; and the effect of righteousness quietness and assurance for ever. 
      — Isaiah 32:17.
Be still and know that I am God. Only when a soul attains this calm can there be true work done, and mind and soul and body be strong to conquer and to bear.
The Peace is the work of righteousness — living the right life, living with Me. Quietness and assurance follow.
Assurance is the calm born of a deep certainty in Me, in My Promise, in My Power to save and keep. Gain this calm, and at all costs keep this calm. Rest in Me. Live in Me. Calm, quiet, assured — at Peace.
Elect according to the foreknowledge of God the Father,
through sanctification of the Spirit, … Grace unto
you, an

September 29 Touching Your Arm And sought Him that they might only touch the hem of His garment; and as many as touched were made perfectly whole. Matthew 14:36 Thy touch has still its ancient Power Yes! when you are quiet before Me I lay My Hand upon each head, and Divine Spirit flows through that healing, powerful Touch into your very beings. Wait in silence before Me to feel that. When you look to Me for guidance My Hand is laid upon your arm, a gentle Touch to point the way. When in mental, physical, or spiritual weakness you cry to Me for healing, My Touch brings Strength and Healing, the renewal of your youth, the power to climb and strive. When you faint by the way, and stumbling footsteps show human strength is waning, My Touch of the Strong and Helping Hand supports you on your Way. Yes! My Children, My touch has still it's ancient Power, that Power is promised to you. So go forward into the future bravely and unafraid.Draft


For many years, Silicon Valley parents (aka tech inventors) have been sending their kids to private low-tech schools and limiting their use of tech, whereas other American families are being told that providing “high tech” educations is what’s best for their kids.  An increasing number of experts and studies continue to warn that this is definitely NOT best for kids (see 123), and it’s not just about eye damage (see 12) from excessive screen use.

When students at a private school in Australia were given a choice between a high-tech education or no-tech education, they chose no-tech.  When American families aren’t given a choice, some are removing their kids from schools.  From The New York Times:

The seed of rebellion was planted in classrooms. It grew in kitchens and living rooms, in conversations between students and their parents.

It culminated when Collin Winter, 14, an eighth grader in McPherson, Kan., joined a classroom walkout in January. In the nearby town of Wellington, high schoolers staged a sit-in. Their parents organized in living rooms, at churches and in the back of machine repair shops. They showed up en masse to school board meetings. In neighborhoods with no political yard signs, homemade signs with dark red slash marks suddenly popped up.

Silicon Valley had come to small-town Kansas schools — and it was not going well.

“I want to just take my Chromebook back and tell them I’m not doing it anymore,” said Kallee Forslund, 16, a 10th grader in Wellington.

Eight months earlier, public schools near Wichita had rolled out a web-based platform and curriculum from Summit Learning. The Silicon Valley-based program promotes an educational approach called “personalized learning,” which uses online tools to customize education. The platform that Summit provides was developed by Facebook engineers. It is funded by Mark Zuckerberg, Facebook’s chief executive, and his wife, Priscilla Chan, a pediatrician.


Then, students started coming home with headaches and hand cramps. Some said they felt more anxious. One child began having a recurrence of seizures. Another asked to bring her dad’s hunting earmuffs to class to block out classmates because work was now done largely alone.

“We’re allowing the computers to teach and the kids all looked like zombies,” said Tyson Koenig, a factory supervisor in McPherson, who visited his son’s fourth-grade class. In October, he pulled the 10-year-old out of the school.

In a school district survey of McPherson middle school parents released this month, 77 percent of respondents said they preferred their child not be in a classroom that uses Summit. More than 80 percent said their children had expressed concerns about the platform.

The resistance in Kansas is part of mounting nationwide opposition to Summit


Parents of special-needs students noticed problems immediately. Amy Jackson, a night-shift nurse in Wellington, has a daughter, Megan, 12, who has epilepsy and whose neurologist recommended she limit screen time to 30 minutes a day to reduce seizures. Since the school started using Summit, Megan has had seizures multiple times a day.


Some parents said they worried about their children’s data privacy.

Photo Gallery


David Buckle



He works, trust .

My Mercies are great to all who turn to Me and to all who turn from me.
How tenderly I yearn over these wayward ones.

How I seek ever to save them from the hurts their very refusal
of Me will bring upon them. I long to save them from the hunger
of loneliness that will follow their driving away the only love that
will satisfy.

it’s 12:00PM, smile, you made it this far,
don’t quit, it will make you sorry, believe you
me. take it from one who has been there before.

oh, and by the way, what it’s for AND about is Him, God.

https://wordpress.com/view/the3rdonlive.wordpress.com https://www.youtube.com/watch?v=yqw9zlK-un0https://wordpress.com/view/the3rdonlive.wordpress.com https://www.youtube.com/watch?v=oHfNY3Ufl88 https://www.youtube.com/watch?v=aI7fe5FsgJg


thank you. May God have mercy on your souls.

The moment we recognize our complete weakness and our complete dependence on Him will be the very moment that the Spirit of God will exhibit His power.

– Oswald Chambers –

https://www.youtube.com/watch?v=x6csBPYfOH8 https://the3rdonlive.wordpress.com/2019/08/23/if-you-only-believe-anything-is-possible-for-those-who-believe 

I am among you as one that serveth.

Yes! remember to serve all.  Be ready

to prove your Sonship by service.  Look

on all you meet as guests in your Father’s

House, to be treated with Love, all consideration, with gentleness.

As a servant of all think no work beneath you.  Be ever ready to do

all you can for others.  Serve. Serve. Serve. There is a gladness in

service, a Joy in doing My Will for others, in being My expression

of all good for them.

Remember that, when you serve others, you are acting for your

Master and Lord who washed His disciples’ feet.  So, in service

Efor others, express your Love for Me.

View more posts


Daily Lesson
The question is not what you will do to get what you want or where you want to be.  The question is what are you willing to give up?  Nothing in this world is free, everything cost, money, time, or love.  The three most important things in our lives.  What are you willing to give up for this world, for the spiritual?

If the message in the Daily Life Lesson is not clear, 
please feel free to ask for clarification or if youwish to submit a Daily Lesson please contact mehisgentletouch@gmail.com

…. https://the3rdonlive.wordpress.com/2019/09/18/801 ….

Daily Lesson

The question is not what you will do to 
get what you want or where you want to 
be.  The question is what are you willing 
to give up?  Nothing in this world is free, 
everything cost, money, time, or love.  
The three most important things in our lives.  
What are you willing to give up for this world, 
for the spiritual?

If the message in the Daily Life Lesson is not clear, 

feel free to ask for clarification and IF you
wish to submit a Daily Lesson please contact me



During our times of becoming or being emotionally and mentally tired, we often focus on how to revenge ourselves from those who come after us with evil intentions. This is not the proper way in how we should handle what looks like to many of our defeat. We should never ask our FATHER in the name of JESUS to bring about harm or to quote back to HIM this scripture, [vengeance is MINE, said the LORD].

Before the crucifixion of JESUS CHRIST, those prayers that we find in the Old Testament would have been sufficient. But after the crucifixion of JESUS CHRIST, they no longer are. During the time when JESUS CHRIST walked among HIS creations, mankind. JESUS spoke and taught about being loving even to those who will come against us.

Nehemiah 4:4 Our FATHER can see clearly that the loads that we are carrying because we have not taken them to HIM, has caused us to become mentally and physically weaken, that our strength is about to fail.

Our FATHER has mercy for us, we have HIS loving-kindness, we have HIS pity. HE is not blind, HE does not turn HIS head to keep from looking at us. HE is aware that some of us are filled up with the contempt and pride of others. They ridicule us because they are arrogant and prideful. The problem is that some of us are not aware of these facts. And because of our ignorance of these facts, we do not live our lives knowing that our FATHER provides us with HIS grace because we are afflicted and humble.





There is no fear in love, Perfect love casts out fear. because fear hath torment. it is he that fears that’s made perfect in love. …………………………………………… 1 John 4:18




_ Elohim (Hebrew: אֱלֹהִים [ʔɛloːˈHim’]) is The Word, The Word was God, and The Word is God. _

Jose San Martin Tue, Sep 24, 9:00 PM (3 hours ago)

Daily Lesson

A house is made of bricks and wood.  

A home is made of love.  Let love be in

every room and in the hearts of all that

live there.  Let it spread to everyone you

meet one by one and perhaps one day we

will have the world that the Lord intended.

Lord, watch over those I love, remind them 

they do not walk alone and guide them with

Your gentle touch. All things work together for good, for them that love the Lord. even the tragic event whereupon this sinner was spared from the end deserved. thank God.

If the message in the Daily Life Lesson is not clear, 
please feel free to ask for clarification or if you wish to submit a Daily Lesson please contact me: hisgentletouch@gmail.comt


i am not afraid to trust in The Holy Spirit. regardless of the recent statements of “i”, and it seeming vain and self-serving, let me assure you: Such is in no way factual, i work for Him.


a sort of enthused effort to garner past viewers to come back.

updated; as are most of the pages Lee puts up

and that being said all are encouraged to visit our sight on all remembered revisiting – there will be no ‘newer’ posts as of a few days ago. we had attempted to gain followers as nest as a wholesome ingredient provider can/could. all lurid posts, the mass of web-traffic seem to go the easy r0ute: seks, dogas & free stuff… “THERE ‘AIN’T NOTHING FREE, AND TOO DAMN LITTLE FOR A BUCK ANYMORE.” – well, there ya have it: the world is all consumed with the god of the air. it’s plan is for to do as you will, forgetting deserved ramifications. to those it is responded with displeasure coupled with pleasure; see… a sinful character are always welcome in Jesus’ corner, just as you are; no past behavior will be remembered, providing a sinners regret/faith is genuine. all are welcome. there is not a ticket, or ANY ‘price’ required. come as you are; He will not be fooled. GO AHEAD TRY. do enjoy His bigmercy to all.

.-.-.-.-. https://wordpress.com/block-editor/post/collactiona.live/2068 .-.-.-.-.

Mark Armstrong, The WordPress.com Blog
Mar 25, 2019

Electric Literature Moves to WordPress — Here’s How an Indie Publisher Thrives on the Open Web
Electric Literature launched 10 years ago in Brooklyn, New York, as a quarterly print journal with a mission to make literature more relevant, exciting, and inclusive. And today they’re celebrating the launch of a new website on WordPress, at electricliterature.com.

Surviving (and thriving) for ten years as an independent publisher is no small feat. Over the years the nonprofit organization has grown its online audience — with offerings like Recommended Reading and The Commuter — while expanding its membership of readers who help fund its work. The website is free to everyone and relies on the generosity of its community to donate to the site and support its mission.

How does an indie website make its business work in 2019? We talked with Electric Lit’s Executive Director Halimah Marcus about some of the lessons they’ve learned in the past 10 years.

Slow and Steady Growth Can Be a Very Good Thing Focus On Your Mission.


Ihagh G. T.
Mar 25, 2019
👍👍👍… inspiring post, especially the longevity,10 years, which includes some other ingredients…I can see a lesson for passionate site owners: their peers ending business, especially when the initial dream was to stay in business without ever leaving. What might have halted them? Well, that would be a story for another day.

Certainly, longevity will bring about many many subscribers/membership. passionate people already have passion, so the watchwords I can perceive from your post are: “persistence, positivity and patience,” we will get there.

Mar 26, 2019
Your mission is a very important one! Keep up the great work and thank you for the inspiration.

Mar 26, 2019
It’s fantastic to read that Electric Literature has been so successful while remaining true to its mission. A real inspiration to us all.

Comments closed.

Child Of God, From The Darkness Into The Light
Dec 15, 2018


Jonathan Caswell
Dec 18, 2018
obedience is better than sacrifice saith the Lord – HOW SO!


Barry – Innerman
Feb 22, 2019
you are indeed a vey wonderful, and powerful woman the Lord is your strength Child Of God

Barry – Innerman
Feb 22, 2019
Thank you, God IS good
David Buckle

Cheri Lucas Rowlands, Discover
Jan 15, 2019

What Would You Do If You Could Do Anything?
What would you do if you could do anything? Tell us in the comments or in a new post.
siusanwbrownCJTCHBHeather’s Blog Spacetanishq Guptachristopherhull8442Esculenta officinalissimplyvaishvhandemaala
Load previous comments from vhandemaala and others

Jan 22, 2019
If I could do anything, I would start a group of orphanages, schools, and shelters for children. All over the world.

Lexygirl Lessons: Requited Therapy
Jan 22, 2019
I would do therapy sessions in a different approach rather than the traditional red tape one. Maybe have a session with client while watching across the beach or a coffee shop rather than dreary clinic

Jan 22, 2019
I would write a song, one that would fill hearts with joy and inspire people to share that joy with everyone. I would play it in coffee shops and bars for coffee and beer. I would release it directly into the public domain so anyone could play it anywhere, and the only thing I would really want from it would be to be remembered after I am gone.

Read More15Likes
Comments closed.

gthielges, gwenthielges.com
Nov 24, 2018

Just Like Joshua
Parents often repeat commands to their children for emphasis. In the first chapter of Joshua, he was told by God to “Be strong and courageous,” three times. God’s words in these verses seem to be a very matter-of-fact way of informing a willing man that the next steps must be taken, and success would not be a part of the equation if strength and courage were absent. The next steps were to obtain the land promised to the Israelites.

God’s marching orders held no promise that a supernatural feeling of courage would well up inside of Joshua’s soul. Nope. No “peace that passes understanding” feeling would signify it was time for Joshua to move. The words feel or feelings do not make an appearance in this chapter. God did not tell Joshua to feel strong and courageous. God told Joshua to be strong and courageous.

Did God promise His presence? Absolutely! But there was no promise that Joshua would not necessarily be shaking in his sandals as he carried out these sacred steps.

TerigthielgesDonna MillerSheri Traxlersusanslandry
Load previous comments from susanslandry and others
Healthy Living Mom
Healthy Living Mom
Nov 28, 2018
Thank you, Gwen, for this encouragement from Joshua. I’ve been camping out in this book for a couple of months and your words are timely. Especially, ” Courage is the strength to keep repeating to ourselves until we believe it that, “God is with me.” Thank you so much!

Healthy Living Mom
Nov 28, 2018
Thank you,

I appreciate your encouraging words! God is surely with us at all times!

Dec 6, 2018
When we rely on God’s courage and confidence,

we can accomplish anything

susan home schooling
Dec 20, 2018
So very true! Thanks for your comment!

path of life devotions, The Path of Life Daily Devotions
Jul 26, 2019

July 26, “Good”

In life there is doing “good” and being good; these things are not always found together.

A songwriter can write a good song without being a good person. A good person may be totally unable to write a good song. Go figure. Good works and goodness are not always companions.

“What Must I Do?”

Tradition calls him, “The Rich Young Ruler.” He had it all (to his way of thinking) but somewhere inside there was a void possessions and position and power did not fill. So He came to Jesus with this question:

“Good Teacher, what shall I do to inherit eternal life?”

Riverside Peace
Riverside Peace
Jul 26, 2018
Great message.
Love the song “God is so good”
Thanks for sharing

path of life devotions
Riverside Peace
Jul 26, 2018
Amen. Such a simple song with such a profound truth, Thanks for reading!

Riverside Peace
path of life devotions
Jul 26, 2018
Your welcome. I make it a habit not to ‘like’ unless I do read. If I love it, I will comment too. Have a great day.

Jul 26, 2018
Means so much!

David Buckle

Enter your comment here…
glastonburyeagle, We Write to Be Human
Jun 11, 2012

Jun 7, 2019

Oct 15, 2015
Might need to update your Bio…;-)

Right Now Counts Forever
the presence of Christ.


Jun 24, 2019

must be,
and how exciting!


David Buckle’s, COLLACTION
Jul 6, 2019

Life’s storms


be ready to go



sweet barbershop? caN YOU DIG THIS? – https://youtu.be/oL1JyDTq3Qc


wanna mug? https://wordpress.com/read/blogs/152707401/posts/374

see, this WHOLE EPISODE WAS THE INTENDED,recall how we figured,

Jose San Martin Wed, Sep 25, 9:00 PM (12 hours ago)

you of all, took me seriously; asked how and the answer was rough?
Thank You!


Daily Lesson

The light has faded into darkness.  

I have lost my way.  My tears are like 

the falling rain.  I have lost my way. 

 all know someone who has, yet we

ignore them and do not reach out. 

A smile, a kind word, or a helping

hand might save not only a life but a soul.


https://youtu.be/HVzpDl7Ale8 this goes out to you, Kim. https://youtu.be/uS90B4sZf7U

like i said: Katie’s brother kinda figured, but he was a senior; not fish friends. recall?







yes, he DID get stuff done; but in that very activity HE DID brake the law;
allot like we, well… at least me. are so capricious with God’s Law.





ya know, people whine a out OUR PRESIDENT, jealousy’s a bitch.

God help us if some yahoo’s placed in Trump’s seat, only God knows what the future. heard today’s gossip in Charlotte: “they’ll br a huge exodus from the United States if Trump loses.”

what’ll occur to this nation IF some wimpy guy, who does not know shit

check from all: us taxpayers, the less significant party hope to interrupt a businessmaster’s method of getting stuff done withOUT his commonsense notions; all except their own greed, and ambition concerned strictly their own selves. OUIR NATION is no democracy at the moment, it isn’t even a republic
when asked by a man: what sort government that the constitutional convention had formulated for the new nation, Benjamin Franklin did memorably reply: “A republic, if you can keep it”

about howto get things done… all the guppies who slid into a sweet pay

hoping to not live in a nation where the ru.ing party forgets Veterans, Social Security (justice), the rule of law. go trump; U.S.’ll be very sorry he doesn’t win.




to connect with my best friend,
Suzanne, her sister, Sheri were
so good to David. May they do
request HimP: join us, the near


Psalm 104

that’s it, you need to go through the valley, just don’t stay in it.

i‘swhat i can do, so i do. don’t worry
about a thing it’s going to be okay…


social media does younger kids no good, ifn’ they do not have the wisdom to peer at images and not be affected, and do not avoid such stuff. our lives are so perfidious and this country’s morals are seriously out of wack, so agreeable to eyes that are continually seeking information. interest are a good attribute for kids and teens. this world we all live in is a wondrous; yet the advertising is… well, you figure it out. once an picture gets more than a glance it is in their malleable minds.

you know when stuff goes bad and falls all apart? you do not understand why this happened not that; like: you really want something for your birthday, or whatever, dudn’t matter… anyway, feel like you’d do anything to get that Christmas gift? and don’t find it under the tree that morning? you know what you call that? we call that life; get used to it. down here we suffer, we can look above; and aim in that direction; for that is where some will be; like forever, singing all the day long thanking Him for including us regular souls that at times are acting in a sinful nature. God knew that we will have those notions to act outside the will of God, yet that is the whole reason for His cross, Jesus Christ goes in our place to suffer the punishment we all deserve.

it’ll fill our minds, in the valley… get that SPRING of the valley.



have you reached the turning point?
it’s coming…
take that turn, my friend.
took disaster to have me on the good foot.
