okay, what does this mean?
Total Audience?
nobody has engaged us…
what? who¿
Engaged Audience
what’s that all ABOUT?
Compared to previous 30 days ??????????????
to: Roxolana, greetings

took a break,
but then again;
it was not such a
successful jaunt, we
were n bad way where
the fact nobody has ever
sent me a message, barring
Patricia; her i enjoy seeing that
she read what i placed on original
website that is a little bit over a year
old. dunno, are you pals at WordPress
intercepting my e-mails?  ones has got to
wonder. if your sight is catching messages in
the helpful spam eliminator that is a welcome in
wonder. if your sight is catching messages before
i see them, okay, it makes me sad that some of your
‘happiness engineers’ seem to have me and my Christ
following marked, as what i have no idea. there is a lot of
situations in the future that we would like to be a benefit to US. i see that the 48 states are receiving WP,

where in HI’s
just A Pinterest sight:

https://www.pinterest.com/DavidBuckle3/boards is a
cool thing… 


experiencing faith failure

eXperiencing the faITH FAILURE – the chief quality of those called having answered on August 17, 1862 Pastor Charles Spurgeon:

You’re about to overcome something, it, you had been dealing with, considering, perhaps battling with for an unmentioned long period of time.your heart and mind

will soon be peace again. patient, everything will be okay.

… The Holy Spirit Glorifying … Jesus Christ

Lalania Riley Hall RIP

The Holy Spirit Glorifying Christ

SOME MAY REBUKE THE NATURAL URGE TO BE ASSISTED, i know the choice to let go, let another in on understand what,

it’s 7:00AM; we consider our own secret that we wouldn’t be

comfortable flashing in public. what would any one think?

.Does our Bible say we can pray private, and be heard?.

In the King James Version of the Bible the text reads and when we pray we should not be hypocritical; see:they love to pray standing in the synagogues and in the corners of the streets, that they may be seen.

Matthew 6:5 


this‘ server will not verify that you, or your mind. we are authorized to access the document requested; but you’re not. Either you typed the wrong credentials (bad password,) or your computer’s brain does not understand how to utilize our service. well, fine then… we think Alex would be upset with you guys. so there.

it isn’t our opinion that any Bible be charged for, censored,

or charged for, it is His letter to us, written by His servants; for US; any who charge fees might be chastised, yet that is not what He‘s about; so take heart.

it is 8:02AM


“God Has No Rival!”

  1. posted on Daily Encouragement:
  2. God Has No Rival!”
  3. A view looking up Kraybill Church Road from our driveway.   “God Has No Rival!”
  4. www.youtube.com/watch?v=0kpJp2W6i9Y



  1. Stephen C. Weber“Changes, Challenges And Choices”
  2. Message summary: Today we will consider changes, challenges and choices. Listen to this message on your audio player.
  3. “Choose for yourselves this day whom you will serve, whether the gods your ancestors served beyond the Euphrates, or the gods of the Amorites, in whose land you are Which of course elicits a number of responses. Bunny then says,
  4. “Today is the day God has given me the opportunity to tell you that Jesus loves you!”Yesterday he went along with us for our chaplain visits, especially looking for opportunities to minister to truck drivers. Our first company yesterday receives many containers from a port and Bunny is seeking ways to share God’s love with these drivers.At this company we have the opportunity to share a brief devotional message early each Tuesday morning so yesterday I asked Bunny to share. He shared that we all have changes, challenges and choices in life which prompted today’s study.Some 3,400 years ago Joshua gave his final challenge to the children of Israel. He had lived his life in steadfast commitment to God. He’s first mentioned in Scripture as the trusted commander of Moses’ army shortly after they crossed the Red Sea during the Exodus. He, along with Caleb, was one of only two spies to bring back a faith-filled report that essentially said, “With God’s help we can do it!”Joshua had faithfully served under Moses during the 40-year period in the wilderness and had led God’s people in the conquest for some 25 years. He’s now 110 years old and musters enough strength for a final challenge to faith and commitment that rings through the ages.The people were experiencing three C’s that people all though the ages have dealt with. 
  5. 1) Changes – The Israelites had entered the promised land under Joshua’s leadership but now were about to experience a change. Things weren’t going to stay the same; there would soon be new leadership. We go through many changes throughout the course of our lives; some major, even life-transforming, others smaller. Most of us really don’t know what change we will encounter today, but great assurance can fill our hearts when we remember that God said “I the Lord do not change” (Malachi 3:6). He is a steady presence in our life, the anchor for our faith when all other ground is sinking sand. Thomas Chisolm reminds us that we can rely on our unchanging God in the hymn classic, Great Is Thy Faithfulness: “Thou changest not, Thy compassions, they fail not. As Thou hast been Thou forever wilt be.” 
  6. 2) Challenges – Changes often bring on challenges. Although the people had entered the promised land many challenges lay ahead for them. Just keep reading and you’ll see one challenge after the other! In our lives changes usually bring challenges as well and just like the Israelites we will receive blessing when we obey God.
  7. Choices – Usually there are choices we must make as a result of changes and challenges, and that makes life hard. Today we will all make many, many choices. Life is just full of choices and decision-making, from tiny daily choices such as what brand of soap to purchase or what to eat for dinner to major, life altering decisions such as our choice for a mate or career. Many choices do not have moral consequences but many others are a choice between right and wrong. “There is a way that seems right to a man, but in the end it leads to death” (Proverbs 14:12). However there is one fundamental choice we all share, based upon today’s portion of Scripture in the Old Testament. Joshua set the fundamental choice clearly before the people with these words, “Choose for yourselves this day whom you will serve”. In the context of Joshua’s challenge their fundamental choice was between serving the one true God and “the gods your ancestors served beyond the Euphrates, or the gods of the Amorites, in whose land you are living.”In a broader sense the choice now and for every generation is whether we serve the one true God or “the god of this world” (2 Corinthians 4:4). Even those who practice the faith of atheism are essentially serving the god of this world. People then and now have this fundamental choice, for the one true God does not force people to love and serve Him.Joshua sets a great example for the people of his time and through all subsequent ages, including our own. Let us proclaim this day, “As for me and my house, we will serve the Lord!”
  8. Be encouraged today,
  9. Daily prayer:  Father, You have drawn us with an everlasting love; You show us Your loving kindness day after day. Your bountiful provision gives to us material, physical and spiritual blessings that only a caring heavenly Father can give. But even though our cup overflows with Your goodness we face changes and challenges amidst our blessing. As we deal with the inevitable changes and the subsequent challenges that follow help us to make the life defining choice, like Joshua, and declare to all who will hear,
  10. “As for me and my house we will serve the Lord.” 





“People are always blaming
their circumstances
for what they are
I do not believe in
The people who get on in
in this world are the people
who get up and look for the
circumstances they wan,
and, if they can’t find them,
make them.”

George Bernard Shaw (1865-1950)


Yea, what he said

could be, should be, so it is now :.)
saved to be secure in life, know there is more than meets the eye
https://www.youtube.com/user/Godiswithusfull TRUST GOD ALWAYS

% God Does Not Want You To Try Harder, He Wants You To Trust Him %


invitations are not only said

To those who know Me not, there is in Me nothing to appeal to them, or to attract them.

Those who know Me there is nothing more to be desired.

“No beauty they could desire Him.”

Oh! My children, draw very near to Me. See Me as I really am,

that ever you may have the Joy of finding in Me all you could desire.

The fulfillment of all you could desire in Master, Lord, or Friend.

such is the this case here, my friend, ‘m not upset…

All Are called… few RSVP, huh?



October 3 — Blessed Assurance
And the work of righteousness shall be peace; and the effect of righteousness quietness and assurance for ever. 
      — Isaiah 32:17.
Be still and know that I am God. Only when a soul attains this calm can there be true work done, and mind and soul and body be strong to conquer and to bear.
The Peace is the work of righteousness — living the right life, living with Me. Quietness and assurance follow.
Assurance is the calm born of a deep certainty in Me, in My Promise, in My Power to save and keep. Gain this calm, and at all costs keep this calm. Rest in Me. Live in Me. Calm, quiet, assured — at Peace.
Elect according to the foreknowledge of God the Father,
through sanctification of the Spirit, … Grace unto
you, an

September 29: Touching my Arm And sought Him that they might only touch the hem of His garment; and as many as touched were made perfectly whole. Matthew 14:36 Thy touch has still its ancient Power Yes! when you are quiet before Me I lay My Hand upon each head, and Divine Spirit flows through that healing, powerful Touch into your very beings. Wait in silence before Me to feel that. When you look to Me for guidance My Hand is laid upon your arm, a gentle Touch to point the way. When in mental, physical, or spiritual weakness you cry to Me for healing, My Touch brings Strength and Healing, the renewal of your youth, the power to climb and strive. When you faint by the way, and stumbling footsteps show human strength is waning, My Touch of the Strong and Helping Hand supports you on your Way. Yes! My Children, My touch has still it's ancient Power, that Power is promised to you. So go forward into the future bravely and unafraid.

They that wait upon the Lord shall renew their strength.

To discover the Pearl of Great Price is to renew your youth.

The Kingdom of Heaven is a kingdom of perennial youth.


hear this

David Buckle

David Buckle
monthly viewers

7,883 Pins nifty..

sadness… See; the above cartoon depicts me look,ing at the3 world inside the cartooning i did at one time… it was 1986 i think, dudn’t matt3er… anyhow – i have a great friend, Eric, who heard David an-nounce whilst leaning Dad’s ping-pong table, Eric was first/second chair french horn, along with Joe… they were both phenomenal musicians, and like me and Laura, swapped 1st and 2nd chairs our senior year at Brazoswood High;

anyhow Joe went on to Baylor, i think, Eric to University of Houston, only after traveling to Europe attending the Brahms School of Music. Eric was that good, SO Eric met, in that music school, France? Germany? Vienna?

well, yo no se’… ANYWAYS he met Guinnivere who was from Charlotte, and he was a nursing assistant at the same Carolina’s Medical Center that was my rehab. too weird, huh? So, that summer, got the first, of four apts,

Thanksgiving of 1993 found me having supper with Guinnivere‘s folks, A wild coincidence, huh? Spoke to him i that year, and he’s in some farm-land in Oregon, or somewhere, built him a cabin, they had two kids, cool.

“man, Charlotte NC‘s where ‘m headed, soon as get through with college” well… i did gOt through with college the first few day’s of October, 1992…

sooo… all’s going according to coincide with my 1988 prayer life… nifty



Parents of special-needs students noticed problems immediately. Amy Jackson, a night-shift nurse in Wellington, has a daughter, Megan, 12, who has epilepsy and whose neurologist recommended she limit screen time to 30 minutes a day to reduce seizures. Since the school started using Summit, Megan has had seizures multiple times a day.


Some parents said they worried about their children’s data privacy.

Photo Gallery


He brings Strength and Healing, the renewal of your youth, the power to climb and strive. When you faint by the way, and stumbling footsteps show human strength is waning, My Touch of the Strong and Helping Hand supports you on your Way. Yes! My Children, My touch has still it’s ancient Power, that Power is promised to you. So go forward into the future bravely and unafraid. is now live. well, we should hope so 8.)

Now unto Him who is able to keep you from falling, and to make you stand in the presence of His Glory blameless with great joy, to the only God our Savior, through Jesus Christ our Lord, be glory, majesty, dominion and authority, before all time and now and forever. Amen.
Jude 1:24-25
4:44 PM (3hours ago)

1976 dave danced all the way to Man-o-War blvd.
Todd produced The Beatles
Todd Rundgren
to Jose, Tim, BE NOT AFRAID! https://youtu.be/bS7Ityj6KmM dig…

Joy!  WCOK the gospel of these mountains – 

David Buckle


OUR testimony
We wouldn’t lie to YOU

He works, trust .

coming from The spiritually reliable source.
hear AND LEArn
My Mercies are great to all who turn to Me and to all who turn from me.
How tenderly I yearn over these wayward ones.

How I seek ever to save them from the hurts their very refusal
of Me will bring upon them. I long to save them from the hunger
of loneliness that will follow their driving away the only love that
will satisfy.

it’s 12:00PM, smile, you made it this far,
don’t quit, it will make you sorry, believe you
me. take it from one who has been there before.

oh, and by the way, what it’s for AND about is Him, God.

https://wordpress.com/view/the3rdonlive.wordpress.com https://www.youtube.com/watch?v=yqw9zlK-un0https://wordpress.com/view/the3rdonlive.wordpress.com https://www.youtube.com/watch?v=oHfNY3Ufl88 https://www.youtube.com/watch?v=aI7fe5FsgJg


thank you. May God have mercy on your souls.

The moment we recognize our complete weakness and our complete dependence on Him will be the very moment that the Spirit of God will exhibit His power.

– Oswald Chambers –

https://www.youtube.com/watch?v=x6csBPYfOH8 https://the3rdonlive.wordpress.com/2019/08/23/if-you-only-believe-anything-is-possible-for-those-who-believe 

I am among you as one that serveth.

Yes! remember to serve all.  Be ready

to prove your Son-ship by service.  Look

on all you meet as guests in your Father’s

House, to be treated with Love, all consideration, with gentleness.

As a servant of all think no work beneath you.  Be ever ready to do

all you can for others.  Serve. Serve. Serve. There is a gladness in

service, a Joy in doing My Will for others, in being My expression

of all good for them.

Remember that, when you serve others, you are acting for your

Master and Lord who washed His disciples’ feet.  So, in service

for others, express your Love for Me.

View more posts


Daily Lesson
The question is not what you will do to get what you want or where you want to be.  The question is what are you willing to give up?  Nothing in this world is free, everything cost, money, time, or love.  The three most important things in our lives.  What are you willing to give up for this world, for the spiritual?

If the message in the Daily Life Lesson is not clear, 
please feel free to ask for clarification or if youwish to submit a Daily Lesson please contact mehisgentletouch@gmail.com

…. https://the3rdonlive.wordpress.com/2019/09/18/801 ….

Daily Lesson

The question is not what you will do to 
get what you want or where you want to 
be.  The question is what are you willing 
to give up?  Nothing in this world is free, 
everything cost, money, time, or love.  
The three most important things in our lives.  
What are you willing to give up for this world, 
for the spiritual?

If the message in the Daily Life Lesson is not clear, 

feel free to ask for clarification and IF you
wish to submit a Daily Lesson please contact me



During our times of becoming or being emotionally and mentally tired, we often focus on how to revenge ourselves from those who come after us with evil intentions. This is not the proper way in how we should handle what looks like to many of our defeat. We should never ask our FATHER in the name of JESUS to bring about harm or to quote back to HIM this scripture, [vengeance is MINE, said the LORD].

Before the crucifixion of JESUS CHRIST, those prayers that we find in the Old Testament would have been sufficient. But after the crucifixion of JESUS CHRIST, they no longer are. During the time when JESUS CHRIST walked among HIS creations, mankind. JESUS spoke and taught about being loving even to those who will come against us.

Nehemiah 4:4 Our FATHER can see clearly that the loads that we are carrying because we have not taken them to HIM, has caused us to become mentally and physically weaken, that our strength is about to fail.

Our FATHER has mercy for us, we have HIS loving-kindness, we have HIS pity. HE is not blind, HE does not turn HIS head to keep from looking at us. HE is aware that some of us are filled up with the contempt and pride of others. They ridicule us because they are arrogant and prideful. The problem is that some of us are not aware of these facts. And because of our ignorance of these facts, we do not live our lives knowing that our FATHER provides us with HIS grace because we are afflicted and humble.





There is no fear in love, Perfect love casts out fear. because fear hath torment. it is he that fears that’s made perfect in love. …………………………………………… 1 John 4:18




_ Elohim (Hebrew: אֱלֹהִים [ʔɛloːˈHim’]) is The Word, The Word was God, and The Word is God. _

Jose San Martin Tue, Sep 24, 9:00 PM (3 hours ago)

Daily Lesson

A house is made of bricks and wood.  

A home is made of love.  Let love be in

every room and in the hearts of all that

live there.  Let it spread to everyone you

meet one by one and perhaps one day we

will have the world that the Lord intended.

Lord, watch over those I love, remind them 

they do not walk alone and guide them with

Your gentle touch. All things work together for good, for them that love the Lord. even the tragic event whereupon this sinner was spared from the end deserved. thank God.

If the message in the Daily Life Lesson is not clear, 
please feel free to ask for clarification or if you wish to submit a Daily Lesson please contact me: hisgentletouch@gmail.comt


i am not afraid to trust in The Holy Spirit. regardless of the recent statements of “i”, and it seeming vain and self-serving, let me assure you: Such is in no way factual, i work for Him.


a sort of enthused effort to garner past viewers to come back.

updated; as are most of the pages Lee puts up

and that being said all are encouraged to visit our sight on all remembered revisiting – there will be no ‘newer’ posts as of a few days ago. we had attempted to gain followers as nest as a wholesome ingredient provider can/could. all lurid posts, the mass of web-traffic seem to go the easy r0ute: seks, dogas & free stuff… “THERE ‘AIN’T NOTHING FREE, AND TOO DAMN LITTLE FOR A BUCK ANYMORE.” – well, there ya have it: the world is all consumed with the god of the air. it’s plan is for to do as you will, forgetting deserved ramifications. to those it is responded with displeasure coupled with pleasure; see… a sinful character are always welcome in Jesus’ corner, just as you are; no past behavior will be remembered, providing a sinners regret/faith is genuine. all are welcome. there is not a ticket, or ANY ‘price’ required. come as you are; He will not be fooled. GO AHEAD TRY. do enjoy His bigmercy to all.

.-.-.-.-. https://wordpress.com/block-editor/post/collactiona.live/2068 .-.-.-.-.

Mark Armstrong, The WordPress.com Blog
Mar 25, 2019

Electric Literature Moves to WordPress — Here’s How an Indie Publisher Thrives on the Open Web
Electric Literature launched 10 years ago in Brooklyn, New York, as a quarterly print journal with a mission to make literature more relevant, exciting, and inclusive. And today they’re celebrating the launch of a new website on WordPress, at electricliterature.com.

Surviving (and thriving) for ten years as an independent publisher is no small feat. Over the years the nonprofit organization has grown its online audience — with offerings like Recommended Reading and The Commuter — while expanding its membership of readers who help fund its work. The website is free to everyone and relies on the generosity of its community to donate to the site and support its mission.

How does an indie website make its business work in 2019? We talked with Electric Lit’s Executive Director Halimah Marcus about some of the lessons they’ve learned in the past 10 years.

Slow and Steady Growth Can Be a Very Good Thing Focus On Your Mission.


Ihagh G. T.
Mar 25, 2019
👍👍👍… inspiring post, especially the longevity,10 years, which includes some other ingredients…I can see a lesson for passionate site owners: their peers ending business, especially when the initial dream was to stay in business without ever leaving. What might have halted them? Well, that would be a story for another day.

Certainly, longevity will bring about many many subscribers/membership. passionate people already have passion, so the watchwords I can perceive from your post are: “persistence, positivity and patience,” we will get there.

Mar 26, 2019
Your mission is a very important one! Keep up the great work and thank you for the inspiration.

Mar 26, 2019
It’s fantastic to read that Electric Literature has been so successful while remaining true to its mission. A real inspiration to us all.

Comments closed.

Child Of God, From The Darkness Into The Light
Dec 15, 2018


Jonathan Caswell
Dec 18, 2018
obedience is better than sacrifice saith the Lord – HOW SO!


Barry – Innerman
Feb 22, 2019
you are indeed a vey wonderful, and powerful woman the Lord is your strength Child Of God

Barry – Innerman
Feb 22, 2019
Thank you, God IS good
David Buckle

Cheri Lucas Rowlands, Discover
Jan 15, 2019

What Would You Do If You Could Do Anything?
What would you do if you could do anything? Tell us in the comments or in a new post.
siusanwbrownCJTCHBHeather’s Blog Spacetanishq Guptachristopherhull8442Esculenta officinalissimplyvaishvhandemaala
Load previous comments from vhandemaala and others

Jan 22, 2019
If I could do anything, I would start a group of orphanages, schools, and shelters for children. All over the world.

Lexygirl Lessons: Requited Therapy
Jan 22, 2019
I would do therapy sessions in a different approach rather than the traditional red tape one. Maybe have a session with client while watching across the beach or a coffee shop rather than dreary clinic

Jan 22, 2019
I would write a song, one that would fill hearts with joy and inspire people to share that joy with everyone. I would play it in coffee shops and bars for coffee and beer. I would release it directly into the public domain so anyone could play it anywhere, and the only thing I would really want from it would be to be remembered after I am gone.

Read More15Likes
Comments closed.

gthielges, gwenthielges.com
Nov 24, 2018

Just Like Joshua
Parents often repeat commands to their children for emphasis. In the first chapter of Joshua, he was told by God to “Be strong and courageous,” three times. God’s words in these verses seem to be a very matter-of-fact way of informing a willing man that the next steps must be taken, and success would not be a part of the equation if strength and courage were absent. The next steps were to obtain the land promised to the Israelites.

God’s marching orders held no promise that a supernatural feeling of courage would well up inside of Joshua’s soul. Nope. No “peace that passes understanding” feeling would signify it was time for Joshua to move. The words feel or feelings do not make an appearance in this chapter. God did not tell Joshua to feel strong and courageous. God told Joshua to be strong and courageous.

Did God promise His presence? Absolutely! But there was no promise that Joshua would not necessarily be shaking in his sandals as he carried out these sacred steps.

TerigthielgesDonna MillerSheri Traxlersusanslandry
Load previous comments from susanslandry and others
Healthy Living Mom
Healthy Living Mom
Nov 28, 2018
Thank you, Gwen, for this encouragement from Joshua. I’ve been camping out in this book for a couple of months and your words are timely. Especially, ” Courage is the strength to keep repeating to ourselves until we believe it that, “God is with me.” Thank you so much!

Healthy Living Mom
Nov 28, 2018
Thank you,

I appreciate your encouraging words! God is surely with us at all times!

Dec 6, 2018
When we rely on God’s courage and confidence,

we can accomplish anything

susan home schooling
Dec 20, 2018
So very true! Thanks for your comment!

path of life devotions, The Path of Life Daily Devotions
Jul 26, 2019

July 26, “Good”

In life there is doing “good” and being good; these things are not always found together.

A songwriter can write a good song without being a good person. A good person may be totally unable to write a good song. Go figure. Good works and goodness are not always companions.

“What Must I Do?”

Tradition calls him, “The Rich Young Ruler.” He had it all (to his way of thinking) but somewhere inside there was a void possessions and position and power did not fill. So He came to Jesus with this question:

“Good Teacher, what shall I do to inherit eternal life?”

Riverside Peace
Riverside Peace
Jul 26, 2018
Great message.
Love the song “God is so good”
Thanks for sharing

path of life devotions
Riverside Peace
Jul 26, 2018
Amen. Such a simple song with such a profound truth, Thanks for reading!

Riverside Peace
path of life devotions
Jul 26, 2018
Your welcome. I make it a habit not to ‘like’ unless I do read. If I love it, I will comment too. Have a great day.

Jul 26, 2018
Means so much!

David Buckle

Enter your comment here…
glastonburyeagle, We Write to Be Human
Jun 11, 2012

Jun 7, 2019

Oct 15, 2015
Might need to update your Bio…;-)

Right Now Counts Forever
the presence of Christ.


Jun 24, 2019

must be,
and how exciting!


David Buckle’s, COLLACTION
Jul 6, 2019

Life’s storms


be ready to go



sweet barbershop? caN YOU DIG THIS? – https://youtu.be/oL1JyDTq3Qc


wanna mug? https://wordpress.com/read/blogs/152707401/posts/374

see, this WHOLE EPISODE WAS THE INTENDED,recall how we figured,

Jose San Martin Wed, Sep 25, 9:00 PM (12 hours ago)

you of all, took me seriously; asked how and the answer was rough?
Thank You!


Daily Lesson

The light has faded into darkness.  

I have lost my way.  My tears are like 

the falling rain.  I have lost my way. 

 all know someone who has, yet we

ignore them and do not reach out. 

A smile, a kind word, or a helping

hand might save not only a life but a soul.


https://youtu.be/HVzpDl7Ale8 this goes out to you, Kim. https://youtu.be/uS90B4sZf7U

like i said: Katie’s brother kinda figured, but he was a senior; not fish friends. recall?







yes, he DID get stuff done; but in that very activity HE DID brake the law;
allot like we, well… at least me. are so capricious with God’s Law.





ya know, people whine a out OUR PRESIDENT, jealousy’s a bitch.

God help us if some yahoo’s placed in Trump’s seat, only God knows what the future. heard today’s gossip in Charlotte: “they’ll br a huge exodus from the United States if Trump loses.”

what’ll occur to this nation IF some wimpy guy, who does not know shit

check from all: us taxpayers, the less significant party hope to interrupt a businessmaster’s method of getting stuff done withOUT his commonsense notions; all except their own greed, and ambition concerned strictly their own selves. OUIR NATION is no democracy at the moment, it isn’t even a republic
when asked by a man: what sort government that the constitutional convention had formulated for the new nation, Benjamin Franklin did memorably reply: “A republic, if you can keep it”

about howto get things done… all the guppies who slid into a sweet pay

hoping to not live in a nation where the ru.ing party forgets Veterans, Social Security (justice), the rule of law. go trump; U.S.’ll be very sorry he doesn’t win.




to connect with my best friend,
Suzanne, her sister, Sheri were
so good to David. May they do
request HimP: join us, the near


Psalm 104

that’s it, you need to go through the valley, just don’t stay in it.

i‘swhat i can do, so i do. don’t worry
about a thing it’s going to be okay…


social media does younger kids no good, ifn’ they do not have the wisdom to peer at images and not be affected, and do not avoid such stuff. our lives are so perfidious and this country’s morals are seriously out of wack, so agreeable to eyes that are continually seeking information. interest are a good attribute for kids and teens. this world we all live in is a wondrous; yet the advertising is… well, you figure it out. once an picture gets more than a glance it is in their malleable minds.

you know when stuff goes bad and falls all apart? you do not understand why this happened not that; like: you really want something for your birthday, or whatever, dudn’t matter… anyway, feel like you’d do anything to get that Christmas gift? and don’t find it under the tree that morning? you know what you call that? we call that life; get used to it. down here we suffer, we can look above; and aim in that direction; for that is where some will be; like forever, singing all the day long thanking Him for including us regular souls that at times are acting in a sinful nature. God knew that we will have those notions to act outside the will of God, yet that is the whole reason for His cross, Jesus Christ goes in our place to suffer the punishment we all deserve.

it’ll fill our minds, in the valley… get that SPRING of the valley.



have you reached the turning point?
it’s coming…
take that turn, my friend.
took disaster to have me on the good foot.





David 2 subscribers





This image has an empty alt attribute; its file name is 6aa91a31ab7d53469b855628c2680b13.jpg
David Buckle3 months ago
Gentle Touch
Jose San Martin 9:01 PM (20 minutes ago)
to HGT
Daily Lesson
Consider the advice of your elders not
because they are always right but because
of the wisdom they have gleaned from
being wrong…Native American quote
As you look back on your younger years
the number of times you thought your
parents were wrong are now echos that
you hear when you try to tell your
children what to do. Remember, you are
never too old to learn from someone even
a few days older than you and never so
old you can not teach someone a few
days younger.

council of God’s Word again.


peace, a relative term; what is named peace is all our own, a very personal belief. air’ a super creation for us. as is the air that gives all the ability to exist. smoking messes with that gift from God. think about it. it is not only your lungs messed up; you are marring your cilium…

Preview(opens in a new tab)

it is, for all intrinsic purposes: The American Indian revenge.

for us stealing THEIR God given lands; to do so much more that it scars, burns, floods God’s home He created for us. smoking breeders cancer coating the villa that changes the air sucked into those superlative organs named lung; why would you want to go all graffiti like upon the engine that is responsible for converting the breeze we create; the one traveling inside the muscular tube that delivers, convey food from that mouth to the stomach and such in humans.

about nine inches (about 23 centimeters) long; passing from the pharynx, down the trachea in front of the spinal column and behind left bronchus where it pierces the diaphragm; slightly to the left of the middle line, and finally: supplies oxygen rich blood to the cardiac organ.

don’t mess with a mechanism we have no business bugging. muscular tube to convey food from the mouth to the stomach and that in humans.

BLOOD: the fluid that houses the soul.

the blood that fuels the machine of ours.

More on WordPress.com

And now for something completely different: Dr. Larry Dixon; The Forgotten Third: Developing a Relationship with God and our Holy Spirit; He illuminates, to believers dwells in us.

it being overemphasized?

overlooked? Is the question regarding our God? Our Holy we need to answer?  

Art Chartier, The Peanut Gallery Saturday Morning, 06 Jul 2019 1 Peter 1:13-25; be Holy in all you do; in the Name of the Father, and of the Son, in our Holy Spirit. Amen. https://youtu.be/gdMo6QTnHrM


This image has an empty alt attribute; its file name is ardmore-barbershop-winston-salem
This image has an empty alt attribute; its file name is d37f9cb6819f4a5e90c073718e9f9dad.jpg

master of chosen instrument

dig Maynard, Herb, Leess



Preview YouTube video Maynard Ferguson “Stay Loose With Bruce”


Preview YouTube video Herb Alpert & the Tijuana Brass A Taste of Honey

https://the3rdonlive.wordpress.com just slip out the back, Jack drop off the key, Lee.Preview YouTube video Primus – Videoplasty – 05 – “Tommy the Cat” (re-edited)













council of God’s Word again.


peace, a relative term; what is named peace is all our own, a very personal belief. air’ a super creation for us. as is the air that gives all the ability to exist. smoking messes with that gift from God. think about it. it is not only your lungs messed up; you are marring your cilium…

Preview(opens in a new tab)

it is, for all intrinsic purposes: The American Indian revenge.

for us stealing THEIR God given lands; to do so much more that it scars, burns, floods God’s home He created for us. smoking breeders cancer coating the villa that changes the air sucked into those superlative organs named lung; why would you want to go all graffiti like upon the engine that is responsible for converting the breeze we create; the one traveling inside the muscular tube that delivers, convey food from that mouth to the stomach and such in humans.

about nine inches (about 23 centimeters) long; passing from the pharynx, down the trachea in front of the spinal column and behind left bronchus where it pierces the diaphragm; slightly to the left of the middle line, and finally: supplies oxygen rich blood to the cardiac organ.

don’t mess with a mechanism we have no business bugging. muscular tube to convey food from the mouth to the stomach and that in humans.

BLOOD: the fluid that houses the soul.

the blood that fuels the machine of ours.

More on WordPress.com

And now for something completely different: Dr. Larry Dixon; The Forgotten Third: Developing a Relationship with God and our Holy Spirit; He illuminates, to believers dwells in us.

it being overemphasized?

overlooked? Is the question regarding our God? Our Holy we need to answer?  

Art Chartier, The Peanut Gallery Saturday Morning, 06 Jul 2019 1 Peter 1:13-25; be Holy in all you do; in the Name of the Father, and of the Son, in our Holy Spirit. Amen. https://youtu.be/gdMo6QTnHrM



master of chosen instrument

dig Maynard, Herb, Leess



Preview YouTube video Maynard Ferguson “Stay Loose With Bruce”


Preview YouTube video Herb Alpert & the Tijuana Brass A Taste of Honey

https://the3rdonlive.wordpress.com just slip out the back, Jack drop off the key, Lee.

Preview YouTube video Primus – Videoplasty – 05 – “Tommy the Cat” (re-edited)














Preview(opens in a new tab)Post updated.View PostAdd titlehttps://www.pinterest.com/davejbuc3/httpscollactionafileswordpresscom2019070-5jpg/M

council of God’s Word again.


peace, a relative term; what is named peace is all our own, a very personal belief. air’ a super creation for us. as is the air that gives all the ability to exist. smoking messes with that gift from God. think about it. it is not only your lungs messed up; you are marring your cilium…

Preview(opens in a new tab)

it is, for all intrinsic purposes: The American Indian revenge.

for us stealing THEIR God given lands; to do so much more that it scars, burns, floods God’s home He created for us. smoking breeders cancer coating the villa that changes the air sucked into those superlative organs named lung; why would you want to go all graffiti like upon the engine that is responsible for converting the breeze we create; the one traveling inside the muscular tube that delivers, convey food from that mouth to the stomach and such in humans.

about nine inches (about 23 centimeters) long; passing from the pharynx, down the trachea in front of the spinal column and behind left bronchus where it pierces the diaphragm; slightly to the left of the middle line, and finally: supplies oxygen rich blood to the cardiac organ.

don’t mess with a mechanism we have no business bugging. muscular tube to convey food from the mouth to the stomach and that in humans.

BLOOD: the fluid that houses the soul.

the blood that fuels the machine of ours.

More on WordPress.com

And now for something completely different: Dr. Larry Dixon; The Forgotten Third: Developing a Relationship with God and our Holy Spirit; He illuminates, to believers dwells in us.

it being overemphasized?

overlooked? Is the question regarding our God? Our Holy we need to answer?  

Art Chartier, The Peanut Gallery Saturday Morning, 06 Jul 2019 1 Peter 1:13-25; be Holy in all you do; in the Name of the Father, and of the Son, in our Holy Spirit. Amen. https://youtu.be/gdMo6QTnHrM


This image has an empty alt attribute; its file name is ardmore-barbershop-winston-salem
This image has an empty alt attribute; its file name is d37f9cb6819f4a5e90c073718e9f9dad.jpg
master of chosen instrument

dig Maynard, Herb, Leess



Preview YouTube video Maynard Ferguson “Stay Loose With Bruce”


Preview YouTube video Herb Alpert & the Tijuana Brass A Taste of Honey

https://the3rdonlive.wordpress.com just slip out the back, Jack drop off the key, Lee.Preview YouTube video Primus – Videoplasty – 05 – “Tommy the Cat” (re-edited)















Music, years before


Peter Gibbons hates his job and the obnoxious Division VP Bill Lumbergh who has just hired two efficiency consultants to downsize the company. His best friends are two software engineers Michael Bolton and Samir Nagheenanajar, that also hate Initech, and his intrusive next door neighbor Lawrence. He believes his girlfriend Anne is cheating on him but she convinces Peter to visit the hypnotherapist Dr. Swanson. Peter tells how miserable his life is and Dr. Swanson hypnotizes him and he goes into a state of ecstasy. However, Dr. Swanson dies immediately after giving the hypnotic suggestion to Peter. Peter, in his new state, starts to date the waitress Joanna and changes his attitude which results in his being promoted by the consultants. When he discovers that Michael and Samir will be downsized, they decide to plant a virus in the banking system to embezzle fraction of cents on each financial operation into Peter’s account. However Michael commits a …
Written by –

Claudio Carvalho, Rio de Janeiro, Brazil

Carolina Theatre is rising again! Buster Keaton approves!

THIS ‘s super description
of His love for us, (U.S.: the
nation devised among those
principals of Christianity.) dig
yup, the country, this country’s
‘This Country, under God;’ see it
right there in OUR national song.

music; the voice of Angels; so true





Mr. Mellow




Skip to content



His child serves Him with thanks… forever. dig: https://www.pinterest.com/davejbuc3/american-heroes/usmc

Nina Hagen spaceage lovesong…

https://youtu.be/akDCUPUgBiQUncategorized 12/22/2019 0 Minutes

roller skates in it for Love ‘Til Tuesday


somuch, Ninais.



x4lX0jKXktY wG5R7vyu-mA These Eyes

Thank you for downloading “Valley Before The Mount.
Midnight Special!

Share this:


Jotun o’ link – 11/1/19 12:02PMIn “Faith”

EVERYBODYWith 4 comments

YOU ARE MAGICAL 8-28In “Faith”Edit “Nina Hagen spaceage lovesong…”

Published by https://youtu.be/akDCUPUgBiQ

Be strong, as able, but if we’re lacking you know where to turn, limitless grace https://www.google.com/maps/place/Arcade+Mens+Room/@35.2255114,-80.8484313,901m/data=!3m2!1e3!4b1!4m5!3m4!1s0x8856a02ede9752a3:0x77a69fe85cd0f36f!8m2!3d35.2255114!4d-80.8462426 Daily Lesson liars lose – action, not words Life is all fun and games until you drive away the one you love. All things have a place in our lives it is just that some are more important than others. The sooner you learn the difference the happier you will be. Never forget the presence; importance of the Lord in your life. do you feel like i do? on the side of the house, just beside the living-room @ NASA Oh, Lee. THANK YOU! not to avoid giving props to my hero, in jazz, and humor: http://www.youtube.com/watch?v=Djc6dldCk3U http://www.youtube.com/watch?v=CsRrg0YoEcY http://www.youtube.com/watch?v=UUhDT70Qhhc —- https://www.youtube.com/watch?v=cB5Qtlu8LjQ&list=RDWE4PoPs8BmU&index=7 —– View all posts by https://youtu.be/akDCUPUgBiQPublished 12/22/2019

Post navigation

Previous Post John squared…Next Post www.pinterest.com/DavidBuckle3/

Leave a Reply

This site uses Akismet to reduce spam. Learn how your comment data is processed.Powered by WordPress.com.


thank you, happiness engineer

The Bible read to you; our suggestion is to read along

But he said to me,

My Grace is sufficient for you, for My Power is made perfect in weakness.

” Therefore I will boast all the more gladly about my weaknesses, so that Christ‘s power may rest on me.

2 Corinthians 12:9

you know what ‘m talkin’ about.

the goal of life is to do what you’re good at; then give it away
You are doing so. This is the way. The way of
uncertain future and faltering steps. It is My Way …
The time has come, when be wise for what you do in the months ahead. Pay Attention.


Scriptures to study for understanding the truth about the end time “catching away” in context: Matthew 24:24-44 1 Thessalonians 4:13-18 and 5:1-11 2 Thessalonians 2:1-12 Mark 13:27 1 Corinthians 15:51 Luke 21:25-28



Who am i going to follow? God? you will never lose with God.

it’s not about me, it’s not about any of the fun nowadays; it’s about Him.

if you are willing to choose, you reap what you sow, you cannot be surrendered to Him beyond, you want God’s best? and are you can be forgiven – He will take you where you are, watch Him work. a forgiveness that Jesus provides all is as active for you as it is for me, and you, and them, and them; even them, them.









Feb. 3, 202o
Charlotte: trade street

. be fearless http://www.youtube.com/watch?v=MKwwokw05Ss .
.- https://www.pinterest.com/davejbuc3/7132019-132pm -.
-. https://the3rdonlive.wordpress.com/2019/09/06/513 -.

hear this,



Front lawn to St. Peters 1999-2017AD

Nina Hagen

remember that radio was gonna be tried?



Maynard Ferguson





If you want 9/7/19 10:00PM

reflect what is true – https://collactiona.live

shine as He does



If you want to work and they want to play, stay away

If you want good and they want bad, stay away.  If you

want a better life you; never find it by being with negative

people.   Be the you that you want to be, not you that they

are.  I know the friends do dope, but I do not.  See the kids over

there stay away; they are dopers.  I know my friends are all failing

in school, I make good grades.  Those kids over there…… stay away

they are losers.  It may not be fair; people are very quick to judge, that

is the world we live in. Want to be a success, hang out with smart people

Want to have great relationship, hang out with those that have one… if you

want a better job, be with ones that have one, may be able to help you get one.


www.youtube.com/watch?v=j1a8FsHTD4U https://youtu.be/tnjL2cx4AUc






this was/is my vimeo

not intentionally sounding mysterious or aloof or vain.
am nothing like that was not then (1989-1992) even.
am on a mission, questions that were posed are here
having been answered: life – a gift; life is a love, life is
still, thank God. am secure, and headed in directions
thought of years earlier, for most of my dreaming has
found the light of day. not selling anything, never will
music is sound, sound is free, we are free: do as we
wish. nothing stands in our way. if, stumbling blocks
arrive, trust that it is in the plan. we’re committed to
where we want to go in life……. see you there!

that being written it takes us back a couple of years…

not too certain, but was a while ago. these comments hold as true today [February 13, 2020 2:00PM] dates for us, times are important. recently it was perplexing SOME webmaster’s seem to require, for themselves at least, a costume they were; virtual like, disguise and or a fictitious look once again: virtual where a god complex

takes root not quite sure what motivates such behavior: said action is attempting, and again, virtually, to warp an instant, or a period of time. BY: announcing to everybody and their dog what times it is, even dates, fall victim in an effort to seem directing time, or placing a few minutes for an added buffer… to their own schedules, as to allow allot

of extra time. maybe a test, or race, or something. don’t, in this imagination, understand why. but it is up to them in the world THEY live in. see, and consider exactly when/how/why any prose is created is for us the mark of, not only in our lives, but each of yours too. history (a favorite subject) seems to me, to fit together neatly. opinions rule in this instance; this is not a

very exact thought (let me get my head strait, wouldn’t dream of causing any misconception) but a malleable notion posed only to
inspire consideration. to encourage memory scanning in original idea formulation. we say memory scanning in loose terms, due to fact no two minds work alike. our selves are formed in those early years; when the brain is more elastic and soluble. the great efforts

that are manipulated by the powers that be to in affect, raise US as the puzzle pieces that, if each created in similar fashion, fit together neatly. as to conform to the rest of the peer-body. and in doing so the creation of dull unenthusiastic followers that don’t question authority. we get opinions from the status quo, and those marks of the valences, the truly unique person needs to bend the will, to become parts of them.

now whether or not the ‘them‘ is good or bad falls back at those opinions of what is or isn’t right. to what exactly, the correct version of whatever of


case in point: this was written long before it being posted today. WT?

𝖎𝖓𝖙𝖊𝖓𝖉𝖊𝖉 𝖋𝖔𝖗 𝖞𝖔𝖚.

could take our USA by storm.well,
it is this squall that this one cares to
educate the masses; NO itchy feeling:
caused by dry scalp. EV3R again forget
paying fees to a shampoo company who
puts profit over effective dandruff cessation

MURRY’S AUSTRALIAN BEESWAX; get some; you’ll see… $3