LET US GET IT FINISHED; AS JESUS CHRIST/GOD FINISHED IT; YET THIS BIGGEST TRUTH; IS ABOUT AN INFERENCE TO WHO, NOT WHAT, IS THE RULER OF MY HEART, THE WORLD TO COME: HEAVEN, THE ETERNAL GIFT. A HOME FOR ALL WHO DILIGENTLY SEEK HIM, NOT him

El

Elohim

_ Elohim (Hebrew: אֱלֹהִים [ʔɛloːˈHim’]) is The Word, The Word was God, and The Word is God. _

Jose San Martin Tue, Sep 24, 9:00 PM (3 hours ago)
https://wordpress.com/block-editor/post/the3rdonlive.wordpress.com/1441
https://en.gravatar.com/davidb48

Daily Lesson


A house is made of bricks and wood.  

A home is made of love.  Let love be in

every room and in the hearts of all that

live there.  Let it spread to everyone you

meet one by one and perhaps one day we

will have the world that the Lord intended.

Lord, watch over those I love, remind them 

they do not walk alone and guide them with

Your gentle touch. All things work together for good, for them that love the Lord. even the tragic event whereupon this sinner was spared from the end deserved. thank God.

If the message in the Daily Life Lesson is not clear, 
please feel free to ask for clarification or if you wish to submit a Daily Lesson please contact me: hisgentletouch@gmail.comt

https://the3rdonlive.wordpress.com/2019/09/25/1441
iT’S WHAT COULD BE DONE, SO THIS IS. I AM FOR
HIM WORKING ,TO ASSIST THE ONLY POWER THAT
KEPT ME ALIVE; AS TO REACH THIS POINT IN LIFE.

i am not afraid to trust in The Holy Spirit. regardless of the recent statements of “i”, and it seeming vain and self-serving, let me assure you: Such is in no way factual, i work for Him.

https://www.pinterest.com/davejbuc3/american-heroes

a sort of enthused effort to garner past viewers to come back.

updated; as are most of the pages Lee puts up

and that being said all are encouraged to visit our sight on all remembered revisiting – there will be no ‘newer’ posts as of a few days ago. we had attempted to gain followers as nest as a wholesome ingredient provider can/could. all lurid posts, the mass of web-traffic seem to go the easy r0ute: seks, dogas & free stuff… “THERE ‘AIN’T NOTHING FREE, AND TOO DAMN LITTLE FOR A BUCK ANYMORE.” – well, there ya have it: the world is all consumed with the god of the air. it’s plan is for to do as you will, forgetting deserved ramifications. to those it is responded with displeasure coupled with pleasure; see… a sinful character are always welcome in Jesus’ corner, just as you are; no past behavior will be remembered, providing a sinners regret/faith is genuine. all are welcome. there is not a ticket, or ANY ‘price’ required. come as you are; He will not be fooled. GO AHEAD TRY. do enjoy His bigmercy to all.

.-.-.-.-. https://wordpress.com/block-editor/post/collactiona.live/2068 .-.-.-.-.

Mark Armstrong, The WordPress.com Blog
Mar 25, 2019

Electric Literature Moves to WordPress — Here’s How an Indie Publisher Thrives on the Open Web
Electric Literature launched 10 years ago in Brooklyn, New York, as a quarterly print journal with a mission to make literature more relevant, exciting, and inclusive. And today they’re celebrating the launch of a new website on WordPress, at electricliterature.com.

Surviving (and thriving) for ten years as an independent publisher is no small feat. Over the years the nonprofit organization has grown its online audience — with offerings like Recommended Reading and The Commuter — while expanding its membership of readers who help fund its work. The website is free to everyone and relies on the generosity of its community to donate to the site and support its mission.

How does an indie website make its business work in 2019? We talked with Electric Lit’s Executive Director Halimah Marcus about some of the lessons they’ve learned in the past 10 years.

Slow and Steady Growth Can Be a Very Good Thing Focus On Your Mission.

chineloanikpeogechukwugmailcom

Ihagh G. T.
Mar 25, 2019
👍👍👍… inspiring post, especially the longevity,10 years, which includes some other ingredients…I can see a lesson for passionate site owners: their peers ending business, especially when the initial dream was to stay in business without ever leaving. What might have halted them? Well, that would be a story for another day.

Certainly, longevity will bring about many many subscribers/membership. passionate people already have passion, so the watchwords I can perceive from your post are: “persistence, positivity and patience,” we will get there.


overbee
Mar 26, 2019
Your mission is a very important one! Keep up the great work and thank you for the inspiration.


Sarahmente
Mar 26, 2019
It’s fantastic to read that Electric Literature has been so successful while remaining true to its mission. A real inspiration to us all.

15Likes
Comments closed.

Child Of God, From The Darkness Into The Light
Dec 15, 2018

SOME OF THE POSTS DO NOT REFLECT ALL I BELIEVE IN BUT IN MOST PART THEY REFLECT MY VIEWS. MY TEACHER HIS THE HOLY SPIRIT. excellent, the best lessons are yet to come


Jonathan Caswell
Dec 18, 2018
obedience is better than sacrifice saith the Lord – HOW SO!

www.pinterest.com/davejbuc3/be-secure-in-life-know-there-is-more-than-meets-th/


Barry – Innerman
Feb 22, 2019
you are indeed a vey wonderful, and powerful woman the Lord is your strength Child Of God

Barry – Innerman
Feb 22, 2019
Thank you, God IS good
David Buckle


Cheri Lucas Rowlands, Discover
Jan 15, 2019

What Would You Do If You Could Do Anything?
What would you do if you could do anything? Tell us in the comments or in a new post.
siusanwbrownCJTCHBHeather’s Blog Spacetanishq Guptachristopherhull8442Esculenta officinalissimplyvaishvhandemaala
Load previous comments from vhandemaala and others

r3alizationz
Jan 22, 2019
If I could do anything, I would start a group of orphanages, schools, and shelters for children. All over the world.


Lexygirl Lessons: Requited Therapy
Jan 22, 2019
I would do therapy sessions in a different approach rather than the traditional red tape one. Maybe have a session with client while watching across the beach or a coffee shop rather than dreary clinic

12Likes
kennynines
kennynines
Jan 22, 2019
I would write a song, one that would fill hearts with joy and inspire people to share that joy with everyone. I would play it in coffee shops and bars for coffee and beer. I would release it directly into the public domain so anyone could play it anywhere, and the only thing I would really want from it would be to be remembered after I am gone.

Read More15Likes
Comments closed.

gthielges, gwenthielges.com
Nov 24, 2018

Just Like Joshua
Parents often repeat commands to their children for emphasis. In the first chapter of Joshua, he was told by God to “Be strong and courageous,” three times. God’s words in these verses seem to be a very matter-of-fact way of informing a willing man that the next steps must be taken, and success would not be a part of the equation if strength and courage were absent. The next steps were to obtain the land promised to the Israelites.

God’s marching orders held no promise that a supernatural feeling of courage would well up inside of Joshua’s soul. Nope. No “peace that passes understanding” feeling would signify it was time for Joshua to move. The words feel or feelings do not make an appearance in this chapter. God did not tell Joshua to feel strong and courageous. God told Joshua to be strong and courageous.

Did God promise His presence? Absolutely! But there was no promise that Joshua would not necessarily be shaking in his sandals as he carried out these sacred steps.

TerigthielgesDonna MillerSheri Traxlersusanslandry
Load previous comments from susanslandry and others
Healthy Living Mom
Healthy Living Mom
Nov 28, 2018
Thank you, Gwen, for this encouragement from Joshua. I’ve been camping out in this book for a couple of months and your words are timely. Especially, ” Courage is the strength to keep repeating to ourselves until we believe it that, “God is with me.” Thank you so much!


Healthy Living Mom
Nov 28, 2018
Thank you,

I appreciate your encouraging words! God is surely with us at all times!


Dec 6, 2018
When we rely on God’s courage and confidence,

we can accomplish anything

susan home schooling
Dec 20, 2018
So very true! Thanks for your comment!


path of life devotions, The Path of Life Daily Devotions
Jul 26, 2019

July 26, “Good”

In life there is doing “good” and being good; these things are not always found together.

A songwriter can write a good song without being a good person. A good person may be totally unable to write a good song. Go figure. Good works and goodness are not always companions.

“What Must I Do?”


Tradition calls him, “The Rich Young Ruler.” He had it all (to his way of thinking) but somewhere inside there was a void possessions and position and power did not fill. So He came to Jesus with this question:

“Good Teacher, what shall I do to inherit eternal life?”

Riverside Peace
Riverside Peace
Jul 26, 2018
Great message.
Love the song “God is so good”
Thanks for sharing


path of life devotions
Riverside Peace
Jul 26, 2018
Amen. Such a simple song with such a profound truth, Thanks for reading!
Steve


Riverside Peace
path of life devotions
Jul 26, 2018
Your welcome. I make it a habit not to ‘like’ unless I do read. If I love it, I will comment too. Have a great day.

ReplyLike
pathoflifedevotions
pathoflifedevotions
Jul 26, 2018
Means so much!
Steve

ReplyLike
David Buckle

Enter your comment here…
SEND
glastonburyeagle, We Write to Be Human
Jun 11, 2012


David
Jun 7, 2019

edharris8
edharris8
Oct 15, 2015
Might need to update your Bio…;-)

Right Now Counts Forever
the presence of Christ.

https://www.pinterest.com/davejbuc3/7132019-132pm

COLLACTION
Jun 24, 2019

must be,
and how exciting!

\o/

David Buckle’s, COLLACTION
Jul 6, 2019

Life’s storms

Published by https://collactiona.live

Do not merely listen to the word, and so deceive yourselves. Do what it says. https://collactiona.live/2019/11/11/11-10-833-33pm-10-2019 James 1:22 --- https://youtu.be/M_Q6ZSzV8iQ --- the3rdonlive.wordpress.com/post/the3rdonlive.wordpress.com/2200 “If you have not built a home, if you do not have a husband, if you do not have a baby, and you are turning 30, and you’re not in some incredibly secure, stable place in your career, or you’re still figuring things out… There’s just this incredible amount of anxiety." Source: The Independent The expectation to have everything she has stated is prominent in our society and unfortunately has made its way into the church. I speak as someone who idolised the thought of having a career and measured my worth by it for many years. Christians have asked me if I rent or buy, if I am having anymore children, and seem to be very interested to find out what I do for a living when they meet me. I know single friends have experienced similar, probing questions about their relationship status. This is all heightened by social media comparisons of family pictures, holidays, possessions, image and more. Sometimes it is hard to see how we are living any differently than those around us. Am I being uptight? I hope not. Nothing is wrong with being single or married, renting or buying, having a career or a different path entirely. However, when any one of those things becomes something we think we should be or have, and are expected and/or entitled to have, we have forgotten that, as Christians, knowing Jesus and being in a relationship with Him is where our true identity and purpose is found. This is the most important thing. He is the one who meets our deepest needs and longings any and every single time. Christians should live with an eternal perspective in mind. The temporary things of this earth will pass away, but God's words will never pass away (Luke 21:33). I would love to see more Christians encourage one another to know Jesus more and to practically love others with this same grace that Jesus has lavished on us. Maybe that will help in addressing some of the stress and anxiety found elsewhere in our lives and the lives of those around us. Christians have good news to share and should be living transformed lives made possible by the work of the Holy Spirit in us. We should be known for our love for God and others. It's worth remembering that Jesus was single and a carpenter by trade before starting His ministry at 30. He met with the poorest, sick and those on the margins of society. He sent His disciples out into the world with no possessions and made it clear that they would have to deny themselves, take up their cross and follow Him (Matthew 16:24). He warned them that they would have trouble in the world, but to take heart because He has overcome the world (John 16:33). Whether we have ticked the box of home, husband/wife, children, career or whatever else we are trying to accomplish in life, the only box that needs to be marked is 'follow Jesus'. And that is marked by His cross. It is His work that brings us a full, abundant life. There is nothing we can do. He loves us immeasurably more than we can imagine. We need to fix our eyes on Him. We do not have to jump through endless hoops in life to be a success or to win God's favour. There is absolutely nothing we can do, but it is all because of Jesus who has made a way for all people to come to Him through the cross. We can have an abundant life in Him which satisfies the deepest longing and searching of our heart. It is a longing, a hunger, a thirst in ourselves that can only be met through Jesus. Come to Him today and He will fill you with His peace if you turn to Him. Therefore we do not lose heart. Though outwardly we are wasting away, yet inwardly we are being renewed day by day. For our light and momentary troubles are achieving for us an eternal glory that far outweighs them all. So we fix our eyes not on what is seen, but on what is unseen, since what is seen is temporary, but what is unseen is eternal. 2 Corinthians - Emma Watson www.pinterest.com/davejbuc3/american-heroes/usmc this could be, should be, so it is now. by David Buckle be secure in life, know there is more than meets the eye https://www.youtube.com/user/Godiswithusfull TRUST GOD ALWAYS www.pinterest.com/davejbuc3/american-heroes/usmc % God Does Not Want You To Try Harder, He Wants You To Trust Him % ._ https://www.pinterest.com/pin/664562488747926086/activity/tried --__ -_ https://the3rdonlive.wordpress.com __- -__ https://the3rdonlive.wordpress.com/2019/09/25/1441 _- -__ https://www.youtube.com/watch?v=wcKTxhvQ12g __- _-_ https://wordpress.com/block-editor/post/the3rdonlive.wordpress.com/422 -=- https://the3rdonlive.wordpress.com/2019/10/17/oct-17-2019ad-953am / hold on for a minute, cool? dig Maynard: https://www.youtube.com/watch?v=zHd3vzyM1fw https://www.youtube.com/watch?v=gDwsxCkbMPY

Join the Conversation

7 Comments

Leave a comment

Fill in your details below or click an icon to log in:

WordPress.com Logo

You are commenting using your WordPress.com account. Log Out /  Change )

Google photo

You are commenting using your Google account. Log Out /  Change )

Twitter picture

You are commenting using your Twitter account. Log Out /  Change )

Facebook photo

You are commenting using your Facebook account. Log Out /  Change )

Connecting to %s

%d bloggers like this: