There is no fear in love, Perfect love casts out fear. because fear hath torment. it is he that fears that’s made perfect in love. …………………………………………… 1 John 4:18




_ Elohim (Hebrew: אֱלֹהִים [ʔɛloːˈHim’]) is The Word, The Word was God, and The Word is God. _

Jose San Martin Tue, Sep 24, 9:00 PM (3 hours ago)

Daily Lesson

A house is made of bricks and wood.  

A home is made of love.  Let love be in

every room and in the hearts of all that

live there.  Let it spread to everyone you

meet one by one and perhaps one day we

will have the world that the Lord intended.

Lord, watch over those I love, remind them 

they do not walk alone and guide them with

Your gentle touch. All things work together for good, for them that love the Lord. even the tragic event whereupon this sinner was spared from the end deserved. thank God.

If the message in the Daily Life Lesson is not clear, 
please feel free to ask for clarification or if you wish to submit a Daily Lesson please contact me: hisgentletouch@gmail.comt

i am not afraid to trust in The Holy Spirit. regardless of the recent statements of “i”, and it seeming vain and self-serving, let me assure you: Such is in no way factual, i work for Him.

a sort of enthused effort to garner past viewers to come back.

updated; as are most of the pages Lee puts up

and that being said all are encouraged to visit our sight on all remembered revisiting – there will be no ‘newer’ posts as of a few days ago. we had attempted to gain followers as nest as a wholesome ingredient provider can/could. all lurid posts, the mass of web-traffic seem to go the easy r0ute: seks, dogas & free stuff… “THERE ‘AIN’T NOTHING FREE, AND TOO DAMN LITTLE FOR A BUCK ANYMORE.” – well, there ya have it: the world is all consumed with the god of the air. it’s plan is for to do as you will, forgetting deserved ramifications. to those it is responded with displeasure coupled with pleasure; see… a sinful character are always welcome in Jesus’ corner, just as you are; no past behavior will be remembered, providing a sinners regret/faith is genuine. all are welcome. there is not a ticket, or ANY ‘price’ required. come as you are; He will not be fooled. GO AHEAD TRY. do enjoy His bigmercy to all.

.-.-.-.-. .-.-.-.-.

Mark Armstrong, The Blog
Mar 25, 2019

Electric Literature Moves to WordPress — Here’s How an Indie Publisher Thrives on the Open Web
Electric Literature launched 10 years ago in Brooklyn, New York, as a quarterly print journal with a mission to make literature more relevant, exciting, and inclusive. And today they’re celebrating the launch of a new website on WordPress, at

Surviving (and thriving) for ten years as an independent publisher is no small feat. Over the years the nonprofit organization has grown its online audience — with offerings like Recommended Reading and The Commuter — while expanding its membership of readers who help fund its work. The website is free to everyone and relies on the generosity of its community to donate to the site and support its mission.

How does an indie website make its business work in 2019? We talked with Electric Lit’s Executive Director Halimah Marcus about some of the lessons they’ve learned in the past 10 years.

Slow and Steady Growth Can Be a Very Good Thing Focus On Your Mission.


Ihagh G. T.
Mar 25, 2019
👍👍👍… inspiring post, especially the longevity,10 years, which includes some other ingredients…I can see a lesson for passionate site owners: their peers ending business, especially when the initial dream was to stay in business without ever leaving. What might have halted them? Well, that would be a story for another day.

Certainly, longevity will bring about many many subscribers/membership. passionate people already have passion, so the watchwords I can perceive from your post are: “persistence, positivity and patience,” we will get there.

Mar 26, 2019
Your mission is a very important one! Keep up the great work and thank you for the inspiration.

Mar 26, 2019
It’s fantastic to read that Electric Literature has been so successful while remaining true to its mission. A real inspiration to us all.

Comments closed.

Child Of God, From The Darkness Into The Light
Dec 15, 2018


Jonathan Caswell
Dec 18, 2018
obedience is better than sacrifice saith the Lord – HOW SO!

Barry – Innerman
Feb 22, 2019
you are indeed a vey wonderful, and powerful woman the Lord is your strength Child Of God

Barry – Innerman
Feb 22, 2019
Thank you, God IS good
David Buckle

Cheri Lucas Rowlands, Discover
Jan 15, 2019

What Would You Do If You Could Do Anything?
What would you do if you could do anything? Tell us in the comments or in a new post.
siusanwbrownCJTCHBHeather’s Blog Spacetanishq Guptachristopherhull8442Esculenta officinalissimplyvaishvhandemaala
Load previous comments from vhandemaala and others

Jan 22, 2019
If I could do anything, I would start a group of orphanages, schools, and shelters for children. All over the world.

Lexygirl Lessons: Requited Therapy
Jan 22, 2019
I would do therapy sessions in a different approach rather than the traditional red tape one. Maybe have a session with client while watching across the beach or a coffee shop rather than dreary clinic

Jan 22, 2019
I would write a song, one that would fill hearts with joy and inspire people to share that joy with everyone. I would play it in coffee shops and bars for coffee and beer. I would release it directly into the public domain so anyone could play it anywhere, and the only thing I would really want from it would be to be remembered after I am gone.

Read More15Likes
Comments closed.

Nov 24, 2018

Just Like Joshua
Parents often repeat commands to their children for emphasis. In the first chapter of Joshua, he was told by God to “Be strong and courageous,” three times. God’s words in these verses seem to be a very matter-of-fact way of informing a willing man that the next steps must be taken, and success would not be a part of the equation if strength and courage were absent. The next steps were to obtain the land promised to the Israelites.

God’s marching orders held no promise that a supernatural feeling of courage would well up inside of Joshua’s soul. Nope. No “peace that passes understanding” feeling would signify it was time for Joshua to move. The words feel or feelings do not make an appearance in this chapter. God did not tell Joshua to feel strong and courageous. God told Joshua to be strong and courageous.

Did God promise His presence? Absolutely! But there was no promise that Joshua would not necessarily be shaking in his sandals as he carried out these sacred steps.

TerigthielgesDonna MillerSheri Traxlersusanslandry
Load previous comments from susanslandry and others
Healthy Living Mom
Healthy Living Mom
Nov 28, 2018
Thank you, Gwen, for this encouragement from Joshua. I’ve been camping out in this book for a couple of months and your words are timely. Especially, ” Courage is the strength to keep repeating to ourselves until we believe it that, “God is with me.” Thank you so much!

Healthy Living Mom
Nov 28, 2018
Thank you,

I appreciate your encouraging words! God is surely with us at all times!

Dec 6, 2018
When we rely on God’s courage and confidence,

we can accomplish anything

susan home schooling
Dec 20, 2018
So very true! Thanks for your comment!

path of life devotions, The Path of Life Daily Devotions
Jul 26, 2019

July 26, “Good”

In life there is doing “good” and being good; these things are not always found together.

A songwriter can write a good song without being a good person. A good person may be totally unable to write a good song. Go figure. Good works and goodness are not always companions.

“What Must I Do?”

Tradition calls him, “The Rich Young Ruler.” He had it all (to his way of thinking) but somewhere inside there was a void possessions and position and power did not fill. So He came to Jesus with this question:

“Good Teacher, what shall I do to inherit eternal life?”

Riverside Peace
Riverside Peace
Jul 26, 2018
Great message.
Love the song “God is so good”
Thanks for sharing

path of life devotions
Riverside Peace
Jul 26, 2018
Amen. Such a simple song with such a profound truth, Thanks for reading!

Riverside Peace
path of life devotions
Jul 26, 2018
Your welcome. I make it a habit not to ‘like’ unless I do read. If I love it, I will comment too. Have a great day.

Jul 26, 2018
Means so much!

David Buckle

Enter your comment here…
glastonburyeagle, We Write to Be Human
Jun 11, 2012

Jun 7, 2019

Oct 15, 2015
Might need to update your Bio…;-)

Right Now Counts Forever
the presence of Christ.

Jun 24, 2019

must be,
and how exciting!


David Buckle’s, COLLACTION
Jul 6, 2019

Life’s storms

%d bloggers like this: